SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023084 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023084
Domain Number 1 Region: 409-528
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-34
Family Pleckstrin-homology domain (PH domain) 0.00085
Further Details:      
 
Domain Number 2 Region: 205-406
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-28
Family DBL homology domain (DH-domain) 0.00069
Further Details:      
 
Domain Number 3 Region: 532-631
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-24
Family I set domains 0.0063
Further Details:      
 
Domain Number 4 Region: 622-717
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-20
Family I set domains 0.0086
Further Details:      
 
Domain Number 5 Region: 123-186
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000374
Family SH3-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023084   Gene: ENSGACG00000017451   Transcript: ENSGACT00000023128
Sequence length 1093
Comment pep:novel group:BROADS1:groupIII:14055166:14062559:-1 gene:ENSGACG00000017451 transcript:ENSGACT00000023128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQSICTAHLGVDQTPQPKKEPKASEVLNITVSAPEEAAGKAKESKTSYLGEVGTEEFLLK
LTNQITEMVSAKITQASLRVPGADSDDETKTPSASPHHGRSRPPSLIADSSSESDEGDAR
GEMCDIYVATADYNPTLASKESISLKEGQYVEVLDSAHPLKWLVRTKPTKNTPSRQGWVS
PAYLDKKLKLSADSSDLPETNSEEVSEGEYKRKLFQLIQELINGESEFVKEMDFFTSHHR
KHADSPDAPPDVSSQTEAIFRNIDDINSFHSKAFLPKLNDCDTDDDVAMCFLKNKEGFEK
YLHYLVGQSLAESAVSDKAVHRFFKEYTDKVQANADPADPPVRSVNASLQQPLERIQKYK
AALKELIRNKAKNGQNCCLLEEAYAMVSALPQRSENTHHVSMIENYPATLDVLGEPMRQG
PFQVWEGAPGIRTSSRGHHRHVFLFKNYCIICKPKRDSNTDTQQYVFKNMMKLNNIDVNE
TVEGDDRAFEIWHEREDSVRKYTLQARTVTIKNSWLRDFRELQQRYSMPAWSPPDFDEIL
ANCTAELGQTVKLACKVTGVPKPAVTWFKDGRAVEADPHHIVIQDPDGSCTLILDNMTAD
DSGQYMCFAASSAGNASTLGKITVQVPPRFVNKMRNATFVAGGDTQFTCVIQSAPNPKIR
WFKDGRLLTDQEKYQTYSELRSGVLVLAIKNLTERDLGHYECELSNRLGTAKCGARLAPP
SAATRGGQAINIEVTEQETRIPKKTIIIEETITTVVKNQRMRRHKSPGLSAAGLHRSETS
TPEPPAARPRRIPTPRKSAIPTLYVTVPEGAEASAPASKPRWVEVEEVIEYKVNKSPRLS
RRRGISPAGPRRSTAANPNTNNSNNKLVEQAQLQGDLSSQPLSWEEEEEGVPSDSATEVT
EEPPGEDSEDLDDDQTIIFEPDDEEEDHNSLGRPQPEILTRGGRVLTLEDLEDYVPEDGE
TFGLSGSREPAAEKPCEISVLQREIGGSTVGQPVLLNVGRPVVVQRQRSGFFGRFREHLS
GSLFSSGVPQASGGQSRTERYVPIQVSHAKVEVKPSYRSEVQRVDGGQQSFKTKVSTQTY
GYTSVGNPVTLQI
Download sequence
Identical sequences G3PZP4
ENSGACP00000023084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]