SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023155 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023155
Domain Number 1 Region: 450-626
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-44
Family DBL homology domain (DH-domain) 0.0000441
Further Details:      
 
Domain Number 2 Region: 636-752
Classification Level Classification E-value
Superfamily PH domain-like 2.29e-37
Family Pleckstrin-homology domain (PH domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 46-152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000691
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023155
Domain Number - Region: 123-260
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000851
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 12-47
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0471
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023155   Gene: ENSGACG00000017523   Transcript: ENSGACT00000023199
Sequence length 925
Comment pep:known_by_projection group:BROADS1:groupII:22471956:22484277:-1 gene:ENSGACG00000017523 transcript:ENSGACT00000023199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDQVEVLFSLKSLQKHVALQQFPAEFGGSSSFSLSSWLCFRSRLEQLTIQCDDVIKLL
QKTVNILQNTPLPAGAEEAEVLLSRYQTMMRSVLEDSRLVQLQQEGGASLSRLRREEGGV
GVALEVVSALYEQVDELLHRLVTLSNARTQELNFILYFKGLEAGFAEVSSWLQDVGEAAL
KTLNEADDSLELLNKKQGDFREFHTAAYDRCRQGEELLSRLDPWGHMTSADLRVYEVKVH
SFWAQLQDFSQRVNTTGQNLERSLELYSFLDQASGWASEGMRHLAAVSMEDCTLPDKCQS
VIGCLEELRLQHPLIPEQRFQEMRAAARELRGERGLRQWSFAWSKCQETKKMFDRKMEAA
LRTRQQLRKSQSFDCPPAPEAPPIGPCTRALSEPRRSGNTGVFIRGLEVSSSEAANRTLC
PRAAGPAPRSPGTPGTTRGPETDPRPRGSKLRHVVEEMVTTEREYVRSLRYIIHHYFPEM
DRSDLPQDLRGKRSVVFGNLEKLLDFHSQFFLRELEACWRHPLRVPHCFIRHKDQFSLYA
LYSKNKPKSDALLHHGNSFFRRKQVELGDKMDLSSYLLKPVQRMSKYALLLTDLIKEVGV
AQEAELATLHAATNMVKFHLRHGNDLLAMDAIRDCDVNLKEQGQLIRQDEFTVWTGRRKC
QRHIFLFEELVLFSKPKKMEGGLDVFIYKHSFKTADVGLTESAGDDGLRFEIWFRRRTSR
NQTFILQATTSEVKHAWTTGIARILWTQATRNKEIRLKEMVSMGVGNKPFLDIQPSDAAI
SDRAVHYIMKSRGARTRASIAVSVFDHSNPFNGGVVTSDLSASGASSSGLLGPLNLHMYS
QNLSPSPAAEGSFITSCVEEEEQETSSQPSMTTESSGSSSRCRSGSTGSDSGCVSSHMPE
EQSHAPNLPSNSQKAVLGISPSTIV
Download sequence
Identical sequences G3PZW5
ENSGACP00000023155 ENSGACP00000023155 69293.ENSGACP00000023155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]