SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023173 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023173
Domain Number 1 Region: 139-213
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.1e-17
Family PHD domain 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023173   Gene: ENSGACG00000017536   Transcript: ENSGACT00000023217
Sequence length 437
Comment pep:known_by_projection group:BROADS1:groupIX:8213256:8216559:1 gene:ENSGACG00000017536 transcript:ENSGACT00000023217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPVSLELDPIFLKGLSYLHSKSKDSVEKLKALLDESLSRGGDSFYRSLQKDIEVSKVS
KLSLSKQDSKSSSSSSSSSSNSEKSKKDSEKRPVEKVRVDLVEVDPPKKPRLEKPESRSS
PITVQTSKDLLPNINDYDETNADDFAMEMGLACVVCRQMTVTMGNQLVECQECHNLYHQD
CHKPQVTDKEVNDPRLVWYCARCTRQMKRMAQKPPQKPSPASASSAPVVKDTLVKKTELK
AKPDTTSTFQAFKRTELKTSTPSANPTSSSSASSGSGLTGWAAFGAKTSPSLAAVSKQGS
SGPSGSHKTLTAPSGQKPVGLSGLAGAKSAQIPGSGNGNGSSQVPLKPPPPLTLGKQPLN
RSSSGEGKGPASSGGGSPSGASGGGNGGSNGGGNGNNGNGSKAAPGDKAPTSQESQLNAM
KRLQLVKKKAAQKKLKK
Download sequence
Identical sequences G3PZY3
ENSGACP00000023173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]