SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023174 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023174
Domain Number 1 Region: 1121-1292
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.16e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000605
Further Details:      
 
Domain Number 2 Region: 557-761
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-45
Family DBL homology domain (DH-domain) 0.00049
Further Details:      
 
Domain Number 3 Region: 2-68
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.96e-32
Family Bcr-Abl oncoprotein oligomerization domain 0.0000298
Further Details:      
 
Domain Number 4 Region: 979-1105
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000327
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Domain Number 5 Region: 777-835
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000344
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023174   Gene: ENSGACG00000017537   Transcript: ENSGACT00000023218
Sequence length 1344
Comment pep:known_by_projection group:BROADS1:groupXIV:8099548:8156144:-1 gene:ENSGACG00000017537 transcript:ENSGACT00000023218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMVEPVGFTEAWKAQFPESEPPRMELRSVGGIEQELEKCKASIRRLEQEVNKERFRMIYL
QTLLAKERKSYDKQRWGFRRTPPLGDGAGRSKPRPPPARKSASHGDGLESAFEVPQQAES
TSCDNLDGLSPSKQRGGISVSPRRLNVPPTDKDLPSDPKDKLGMGLGVAALRSNFERIKR
ANSHSVGDVAKGQEKQQQQQLPPPPPPFYSNMEFHHERGLVRVNDRDVSDKISSLGTQAM
QMERKRSLHSLPGNLATAAGELRARPVYRGRSTESTCGYDAEYEDGEPNQRHAGRANGGK
PPPPPWQPSEFQAYSSVYVGGVMMGEGGVGDGRVGGGSGGGVTMRELGGGDDHLLTWPRR
SYSPGSFEDVGGGGGYTPDCSSNENLTSSEEDFSSGQSSHVSPSPTTAFRRPFREKSRSP
SQNSQNSQHSFDSSSPPTPQSQKRQHRQQGGHVVMSEATIVSVRKTGQIWPPGAHHDLVP
HGRTSHDNSFHGDHLDGHFTGTPPTYGYDADRAEEQRRHHDILPYIDDSPSSSPHLSSKS
RSSRDTLSSGSLESSKSTECDLEKGLEMRKWVLSGILATEETYLSHLEALLLPMKPLKAA
ATTSQPVLTLAQIETIFFKVPELYEIHREFYDGLFPRVQQWGHHQRVGDLFQKLASQLGV
YRAFVDNYELAVETAEKCCQANTQFAEISENLKVRSPKDSKDQTAKNSLEALLYKPVDRV
TRSTLVLHDLLKHTPTSHPDHPLLQDALRISQNFLSSINEETTPRRQSMTVKKGESRQLL
RDSFMVELVEGARKLRHVFLFTDLLLCAKLKKQIGGKNQQYDSKWYIPLTELTFQGPEET
EPLTIPQVPDEELDAIKVKISHLRCEIQREKRGNKSSKVIDRLRKKLTEQESLLLLTSPS
LPIRVYNKSGKGYSFLISSDYERAEWRELMKEQQKKCLKTSSLTSVELQMLTNSCVKLQT
VHHIPLSINKEEDESPGLHGFLNVIVHSASGLKQSLNLYCTLEVDSFGFFSSKAKTRVYR
YTTEPKWNEEFEIELEGSQTLRLLCYEKCYNKTRQNKEDGESADRIMGKGQIPLDPPTLQ
GKDWQRTVIPMNGGQIEVKLSMKFTSREFSLKRMPSRKPMGVFGIKISAVTKRERSKVPY
IVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNHKDVSVMMSEMDVNAIAGTLK
LYFRELPEPLFTDDLYPSFAGRHHAALSDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLK
RVAEKEGINKMSLHNLATVFGPTLLRPSEKDSKIPTNPTQPISMGDSWSLEVMAQVQVLL
YFLQLETIPTPDSKRQSILFSTEV
Download sequence
Identical sequences G3PZY4
ENSGACP00000023174 69293.ENSGACP00000023174 ENSGACP00000023174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]