SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023259 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023259
Domain Number 1 Region: 152-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.19e-26
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-55
Classification Level Classification E-value
Superfamily UBA-like 1.44e-16
Family UBA domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023259
Domain Number - Region: 92-174
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0119
Family C-terminal domain of PLC-beta 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023259   Gene: ENSGACG00000017599   Transcript: ENSGACT00000023305
Sequence length 292
Comment pep:known_by_projection group:BROADS1:groupIV:8225912:8229882:-1 gene:ENSGACG00000017599 transcript:ENSGACT00000023305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTTLESLLEMGFERNRAEKAVANTGNQGIEQAMDWLMEHENDPDIDEPFVPPVGNVL
GGEADSTADGVGNYDNDDTSARMPMSEEEKLEQVRRLEELMRVKQAERRERERAEELERE
KQRRRQGQELQQIRQKLQDDDMKKLADQRMKEKMEDKMARQRVKDKIARDREERAQKFGG
IAPPSTASSSQPAQPSPSSPTSHGPPPTKKEYDESRIQVRLLDGSTLTAVFKAQEPLAAV
RVYVQVNGNTPEGQDFTLLSPYPRHVYTELDMEKPLKELGLVPSAVLVVAKK
Download sequence
Identical sequences G3Q069
ENSGACP00000023259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]