SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023281 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023281
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.06e-36
Family GABARAP-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023281   Gene: ENSGACG00000017618   Transcript: ENSGACT00000023327
Sequence length 131
Comment pep:novel group:BROADS1:groupIV:8247807:8248593:-1 gene:ENSGACG00000017618 transcript:ENSGACT00000023327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFEKSMEMMSFKQRKCLETRKDEVCTIRTKFPNKLPVIVERYIREKTLPLMDKTKFLV
PFELTLGQFLCLLRNKISLDSTQALFLLVAEKSMSCMSSSMGEVYSHHSDTDGFLYITYA
SQEMFGAPGPA
Download sequence
Identical sequences G3Q091
69293.ENSGACP00000023281 ENSGACP00000023281 ENSGACP00000023281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]