SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023303 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023303
Domain Number 1 Region: 325-390
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.1e-17
Family PHD domain 0.0041
Further Details:      
 
Domain Number 2 Region: 216-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000524
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 280-340
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000936
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023303   Gene: ENSGACG00000017632   Transcript: ENSGACT00000023349
Sequence length 406
Comment pep:known_by_projection group:BROADS1:groupIV:8270521:8276880:1 gene:ENSGACG00000017632 transcript:ENSGACT00000023349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVDSVVKVLGEQYYRDAMEQCHSYNARLCAERSILMPFLDSQTGVAQSNCYIWMEKR
HRSAGVAPGQLYTYPARRWRKKRRSHPPEDPRLAFPPLKADLELGLKREALGPVDGSSLE
ALLKGEPLDRRSGVSDLRGPEDDSAAVEPPATSATTHSSSGRVRKRVLDHDDYLDDLDDD
DFEDETPKRRGKSKSKGRSDKNGKKKQEAAAAALEERDKPYACDICGKRYKNRPGLSYHY
THSHLAEEEGEDREEIEAPPTPRQPEEQKTTKKGPNGLAMPNDYCDFCLGDSTLNQKTGQ
SEGLVSCSDCGRSGHPTCLQFTPVMMAAVKTYRWQCIECKCCNVCGTSENDDQLLFCDDC
DRGYHMYCLSPPMTEPPEGSWSCHLCLLLLKDKASIYQQNQSSTPE
Download sequence
Identical sequences G3Q0B3
ENSGACP00000023303 ENSGACP00000023303 69293.ENSGACP00000023303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]