SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023436 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023436
Domain Number 1 Region: 22-145
Classification Level Classification E-value
Superfamily PH domain-like 4.87e-21
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 184-271
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000178
Family SH2 domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023436   Gene: ENSGACG00000017735   Transcript: ENSGACT00000023482
Sequence length 278
Comment pep:known_by_projection group:BROADS1:groupIV:9176308:9178445:1 gene:ENSGACG00000017735 transcript:ENSGACT00000023482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSRNMSLPARVVHKRRETITELPLYYSGHLLKKLTKEKDFKKYYGELRGATLFLYKDDTQ
DTYTEKLNLEQLKSMELDSPYESKTPTIFTLTLHTQEVQLKMENCDTGEEWRGYILTVVK
KEIPSNMQLLPGQMLLLQCALDQERRRNPPKACPPLPPRPLFLRQPPLSTTAGKDELDNC
APELPTCFFSVTRLEAEKMLEENPECGSIILRPSTLANNYALTLRQLMPSGPVMKNFRLT
STNSGFVIELDTPVRVSSLNEVLKYFMEMTEYRLHPFL
Download sequence
Identical sequences G3Q0P1
69293.ENSGACP00000023436 ENSGACP00000023436 ENSGACP00000023436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]