SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023440 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023440
Domain Number 1 Region: 65-343
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.06e-52
Family Asparaginyl hydroxylase-like 0.061
Further Details:      
 
Domain Number 2 Region: 880-1113
Classification Level Classification E-value
Superfamily RNI-like 8.04e-23
Family 28-residue LRR 0.055
Further Details:      
 
Domain Number 3 Region: 586-652
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000089
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023440   Gene: ENSGACG00000017741   Transcript: ENSGACT00000023486
Sequence length 1134
Comment pep:known_by_projection group:BROADS1:groupIV:9188139:9197982:-1 gene:ENSGACG00000017741 transcript:ENSGACT00000023486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENMEDPHTRYSKRLRTGTRRRYQDDGISDDEIEGKRMFDLDEKLECVRFKSDLVKHMAGK
DFTFEYIQREGLRDPIIFDTADGLGIQMPDPDFSVSDVKLFVGSRRIVDVMDVNTQKGIE
MSMAQWRRYYDTPPSEREKLYNVISLEFSHTRLENLVKRPASVDLIDWVDNMWPRHLKER
QRDSTNAIIEMHYPKVQKYCLMSVQGCFTDFHIDFGGTSVWYHILRGGKVFWLIPPTPSN
LDMYENWVLSGKQGDIFLGDKCYDCQRIELKQGNTFIIPSGWIHAVYTPEDTLVFGGNFL
HSFNIPMQLNIYSIEDRTRVPAKFRYPFYFEMCWYVLERYLYCQTNISHLTPEFQKHSLG
IDRRVNEFATDGKVTFALLSGLTQADHEANDQTKNVSNGVDSETEVKESIIKEEEFLQEE
APKVAPPQPMLTPFELEGLWNLLGKLEELPDQKKCVPVGIMDAAALIRDMRTLLEGHTND
NPKFSYTGEPIVKWPERPSWYQPPTPPPPVIYRPRLAPTLHKPLCQRPTKRSSISALRRR
RVRCKRCAACCRKECGTCQFCHDMRKFGGTGRMKKGCLMRRCLAPALPNTARCAVCGEGE
FDESNPSTYSLMECSVCSQIVHHQCIKEPGDGKINDDLPSCWECPKCYQGKDSEHQQNRK
RANALELRLKKRVNLSHPTEAGDPGPLSPAAALQGFVPASLSNQQTISDEQEENGQTLGR
GLDKENQPQSRRGGRAAKEKDEAASEVANQNGAEEEEEQQGSETRGKDRPFLKVTLQRPT
RAKHDPSAIVPKLEAIAPQTATSTIHNQARILVRPPIRNPGPCPDPHPNRHLAPHARGKH
TDTRASEGGSEADRENGGSGPGCEREVWVSVFRYLSRADLCVCMAVCKSWYKWCLDKRLW
ARIDLSIKRTVTPQALTGIIKRQPVTLDLSWTNISKKQLNWHLVSDFPGLKDLMVAGCSW
LTISALCSCGCPLLRSLDLRYADGVKDSQIRDLVTPPDNSAPGCDNRSQFRTMQCLRLAG
LDISDSTLRLVIRHMPHLTKLDLSHCNSLSDHSINLLTAVGSSTRNTLTELNLGGCSRLT
DVSLKYLRRLSCISLLDLRGCKGVSRQACEAFISELSVNALYCLSDEKLIQRIS
Download sequence
Identical sequences G3Q0P5
ENSGACP00000023440 ENSGACP00000023440 69293.ENSGACP00000023440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]