SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023448 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023448
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-27
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.68e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023448   Gene: ENSGACG00000017748   Transcript: ENSGACT00000023494
Sequence length 244
Comment pep:known_by_projection scaffold:BROADS1:scaffold_137:157404:162580:1 gene:ENSGACG00000017748 transcript:ENSGACT00000023494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANSKRIAVVEGCFGAAGQPLAIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIMIQKKKYNKQHIIPLESVTIDKVPDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHIGKCVEDLLLKSGKAPTGEHAAVWVPDSEATVCMRCQKVKFTPVSRRHHCRKCGF
VVCGPCSERKHLLPSQSSKPVRVCEFCFVQLTAEGAAARSDSLGRLGSKFHNMSDDDDDD
DSSD
Download sequence
Identical sequences G3Q0Q3
ENSGACP00000023448 ENSGACP00000023448 69293.ENSGACP00000023448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]