SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023488 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023488
Domain Number 1 Region: 18-469
Classification Level Classification E-value
Superfamily Ras GEF 1.16e-110
Family Ras GEF 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023488   Gene: ENSGACG00000017774   Transcript: ENSGACT00000023534
Sequence length 473
Comment pep:known_by_projection group:BROADS1:groupXIV:9234280:9239810:-1 gene:ENSGACG00000017774 transcript:ENSGACT00000023534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPTTPYAGKFSPCAPYGNNNNNHPAPHSYGEMCYHDNSLVSASLEALIQHLVPTVDYYP
DRSYVFTFLLSSRLFLHPYELMTRVCHLCVEQQRSGDALLDKIRFREVAPKLVQLLTEWT
ETFPYDFRDERMMRCLNDMTQHVARGDEYSWRAMQQMTQRLIKRLSALGQYEEAVSALSA
VAMERPASLKGRQAAGQRGDVMSACDDPFVLAQQLTHIELDRLSFIGPEEFIQTFAMKDP
LENHKGFFRKRKTSNLEAYINWFNRLSYLVATEICMPVKKKQRARIIEFFIDVAQECFNI
GNFNSLMAIITGMNMSPVARLRKTWSKVNTDKFEILEHQMDPSSNFTNYRTALRGATQRS
ETAHSSQEKIVIPFFSLLIKDIYFLNEGCASKLTNGHINFEKLWELAKQVSEFLVWRQVI
CPFDRDRRILQYLVTTPVFTEDELHLASYESEGPENNMEKDSRRSLRWVHARS
Download sequence
Identical sequences G3Q0U3
ENSGACP00000023488 ENSGACP00000023488 69293.ENSGACP00000023488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]