SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023531 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023531
Domain Number 1 Region: 195-428
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-84
Family SSRP1-like 0.00000466
Further Details:      
 
Domain Number 2 Region: 536-618
Classification Level Classification E-value
Superfamily HMG-box 1.23e-24
Family HMG-box 0.0000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023531   Gene: ENSGACG00000017801   Transcript: ENSGACT00000023577
Sequence length 709
Comment pep:known_by_projection group:BROADS1:groupIV:9247188:9256786:-1 gene:ENSGACG00000017801 transcript:ENSGACT00000023577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDTLEFSDIYQEVKGSWNDGRLRFGKQSVVYKSSKTGKVDSIPAGDLNLAQWRRVCLGH
GIKLGTGSGHIYKYDGFRDTDFEKISEFFKANYKVELAEKDMCVKGWNWGTAKFSGPLLS
FEVNESTAFEVPLANVSQCATGKNEVTLEFHQNDDTEVSLMEVRFYVPPSQTDERQDPVE
AFAENVLSKADVIQATGDAVCIFKELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTV
LRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKEEDLTLTLNMSEDDVERRFE
GKLSKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGF
IYVHKPPVHLRFEEISCVNFARGTTTTRSFDFEVETKQGNQFTFSSIEREEYGKLFDFVN
AKKLNIKNRGFKEGMKGKIDEYSDSDEDQHDAYLERMKAEGKIREEGNDSEESDGESDES
FNPGEEDDDIAEEYDSNASASDSSDDGDDDDDSSKKKAPKVKVVKEKKERKPRREQKKQK
DKGGPKRPMSAYMLWLNSSRERIKSENPGISITEISKKAGEMWRQLGKDDKEEWDIKAAE
AKRQYDKAKQEYKESGGGEAAAPAATSSSKNKKSGGVKEEKKRKSAGGDKEKERAAANDS
FKSREFIETSEESSSDTDRKSKSKRKKESDDDEMEEEAVSTPASSEEES
Download sequence
Identical sequences G3Q0Y4
69293.ENSGACP00000023531 ENSGACP00000023527 ENSGACP00000023531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]