SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023565 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023565
Domain Number 1 Region: 33-144
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000602
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.012
Further Details:      
 
Domain Number 2 Region: 250-316
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000916
Family Ubiquitin-related 0.019
Further Details:      
 
Domain Number 3 Region: 353-380
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000222
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023565   Gene: ENSGACG00000017834   Transcript: ENSGACT00000023611
Sequence length 403
Comment pep:known_by_projection group:BROADS1:groupIII:16079996:16084101:1 gene:ENSGACG00000017834 transcript:ENSGACT00000023611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSGGWAPPAAVPSASSQPAACAAPTPCCGTVLMSVRVSVCHSGIRPLCLPGAGGEAL
RLQLGMDPSRAGEFRLALRDTSGNRSVFIAEFDLRSVQYEVKSPRCHEMRLVAPPRDCIR
FNFRCDREAEEWATVVMSSLREAHRGTRVNRTPGATTQRLRSRGAPPPCRSPVGTRPLSR
LPRRVLNLLSEELCLELAGAIEAGDARAASQHAAALARHRSALTIQPSEKNYAEGAVSLS
VVVEDVSSSCCVTVKVFPFMTVAALKQQVFLEYGFHPRVQRWVIGQCLCTEPRSLASYGV
QKDGDAAYLYLISARQAHVTRQLFQQDLESALLAPPLPPGNGPASQCFPFELDQTEWACP
SCTFINKPSRPGCEICATARPELHIQQERGRREERGDAASSSS
Download sequence
Identical sequences G3Q117
ENSGACP00000023565 69293.ENSGACP00000023565 ENSGACP00000023565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]