SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023639 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023639
Domain Number 1 Region: 4-129
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-22
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 459-547
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000553
Family SH2 domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023639   Gene: ENSGACG00000017890   Transcript: ENSGACT00000023685
Sequence length 553
Comment pep:known_by_projection group:BROADS1:groupXIV:10263115:10267749:-1 gene:ENSGACG00000017890 transcript:ENSGACT00000023685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPEISWPVPMPAIGAQNLLTMPGGVSTSGYLHKKGGSQFSLLKWPLRYIIIHKGCMYY
FKSSTSPAPQGAFSLNGYNRVMRAAEETTSSNVFPFKIVHFSKKHRTWLFSAASEDERRK
WMRYLRREIDHYNERKESHFPSLSDSDSDAEKFYGTIETLMDIKHHVDNAEDEYGNDDED
DDEDDYLEPDSDSPTSTGRPTAPPPSYPPPPVPVSFHQRQDSSPAYQKGAPPPVPPLHRI
PTSPLPKKPPPAHPPPSFLKEPYKGAPPPPPLVSLPHRSVSPTPPPPPPPNAKRSPPCRV
TSVGGPGSNKRDWRPLPAVSVQTPATLPICEKLASDFLSPSKTPSSHPPLHGPPALSPLL
KPHKKSGIPKPPPPTLKPPLPADTCNPPGTPLNTKMLSPPPRRASPDGQSFRSLGDETPT
ESRWKQGSNKRGGGEESDDDDYEDVLLPDSVFIDTTDTCFIENMFRESAMAPQDGLYCIR
NSVTKTAKVLVVWDVSIGKARNYRLFEEEDRIFLDNDIPFTSLSAVMEHYHKHPLPHHGS
LRLQKPYQNIPGR
Download sequence
Identical sequences G3Q191
ENSGACP00000023639 ENSGACP00000023639 69293.ENSGACP00000023639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]