SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023700 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023700
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-23
Family PDZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 185-264
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000105
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 286-390
Classification Level Classification E-value
Superfamily PH domain-like 0.000000268
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023700   Gene: ENSGACG00000017936   Transcript: ENSGACT00000023746
Sequence length 525
Comment pep:known_by_projection group:BROADS1:groupIII:16441241:16461828:1 gene:ENSGACG00000017936 transcript:ENSGACT00000023746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFKTSNEETKTGIYLMQEGNEEPFNIRLHLARDILTIQEQDVICVSGEPFYSSERTVTI
RRQTIGGFGLSIKGGAEHKIPVVISKISKEQKAELSGLLFIGDGILQINGINVRSYRHEE
VVQVLRNAGEEVTLTVSFLKKTPAFLKLPLCEDCTCVPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPACPGLRWEKRWVDLRLIPLLHSRLSQYNPGSDVCRKNAFQVIAVDGVC
SGVLQFLTADDCLDWLQALASNISSLTKHNVKKINRNFPVNQQIIYMGWVDEKEQDSVQD
RMYSPKFLALRGSSLFKFSAPPVTTWDWTRAEKSFTVYEIMCKILKDNDLLDKRKHCFGV
QTESGEDLFFSVELECELLIWEKAFQMATFLEVERIQCKTYACIMESHLMGLTVDFGAGF
VCFDAASKAVLWRYKFSQLKGSSDDGKSKIKFLFQNQDSKSIEAKELEFSNLFAVLHCIH
AFFAAKVACLDPIFVESQGNATPAGFPSLCSISCNSQTPKLKYAT
Download sequence
Identical sequences G3Q1F2
ENSGACP00000023700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]