SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023701 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023701
Domain Number 1 Region: 577-710
Classification Level Classification E-value
Superfamily PH domain-like 8.12e-39
Family Phosphotyrosine-binding domain (PTB) 0.00000372
Further Details:      
 
Domain Number 2 Region: 415-556
Classification Level Classification E-value
Superfamily PH domain-like 4.36e-30
Family Phosphotyrosine-binding domain (PTB) 0.0063
Further Details:      
 
Domain Number 3 Region: 282-320
Classification Level Classification E-value
Superfamily WW domain 0.00000000263
Family WW domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023701   Gene: ENSGACG00000017942   Transcript: ENSGACT00000023747
Sequence length 761
Comment pep:known_by_projection group:BROADS1:groupIV:10528024:10551725:1 gene:ENSGACG00000017942 transcript:ENSGACT00000023747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVQTPPLSRSGSSPSNVGLANRSGTSATPPTSLSLRSSYNQLLGRDVIKESMESGSSAT
LPKSRQRYAMTSVRSAMGISDNLASSSLFNTTNPKLAKNGANMQRRAESQQQELSRANTE
GKIHTDLINNPSSDWLELGKDNSQLPPFRRRTKSFFEHPGKGWDLDLSLGNKEDEEEEKK
QQPSPEKEQASPAKVELHPNNENQFLQQFPPSSPKLARTAERYTPTRNRAPPTVPDAGHD
TGLPRVGLRMDLTPETPSEEEDSSWTTLSQETPSPQTPRETADVWGEGNLPPGWREISDS
SEIYFWHIPTGTTQYHRPVASGDEHTSPSKGPDTDSVEPVPSPSGSSPSPSSSTVLDDAS
SEVNITTWTSLIISSMYPDPSLKAFEGATLRYASLKLSASAQLETVDLNNSSSHPEAMSF
PVRSLGWVEMAEQDLCEGRSSLAVHHCIRQLSYCRRDIRDSAGVWGEGKGMLLVLQDRML
TLVDPDDGSLLHSQPISSIRVWGVGRDHDRHKEGDFAYVARDKNTRVLKCHVFRCDTPAA
AIATSLHEICSKIMAERKSAKAAAGSSSQNGSDVPLQAEFPMPKTELVQKFHVLYLGMTS
VSRPIGMDIINGAIESLVSSTGKEDWTPVTLSIADTTLAVIKEKEEEEEVLVECRVRFLS
FMGVGRDVHSFAFVMDTGSQHFHCHAFWCDPNAGNVSEAVQAACVLRYQKCLVARPPSQR
AGSSSSPSADTVTRRVTTSVKRGVQSLIDTLKTKKQPSELP
Download sequence
Identical sequences G3Q1F3
ENSGACP00000023701 69293.ENSGACP00000023701 ENSGACP00000023701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]