SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023719 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023719
Domain Number 1 Region: 76-188
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00036
Further Details:      
 
Domain Number 2 Region: 200-312
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.75e-17
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 12-61
Classification Level Classification E-value
Superfamily PH domain-like 0.0000014
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023719   Gene: ENSGACG00000017957   Transcript: ENSGACT00000023765
Sequence length 330
Comment pep:known_by_projection group:BROADS1:groupIII:16608383:16618336:1 gene:ENSGACG00000017957 transcript:ENSGACT00000023765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRRVSLVASRFYRTEDSFEFVIVSLTGQTWNFEASTFEERELWVGAIESQIFASLQSCES
IKNKSRLGSQSDAMAIQSVRNVRGNSFCVDCDAPNPDWASLNLGALMCIECSGIHRNLGT
HLSRVRSLDLDDWPVELSMVMTAIGNAMANSVWEGALEGYAKPGSDSAREEKERWIRAKY
EQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLS
CAMANVVITQLLIWYGVDVKSRDARGQTTLSCARRAGSQECADILLQHGCPNDAGSLASV
TTPDMSRRNPNPNVNNNNAQCELNRSISIM
Download sequence
Identical sequences G3Q1H1
ENSGACP00000023719 69293.ENSGACP00000023719 ENSGACP00000023719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]