SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023791 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023791
Domain Number 1 Region: 121-218
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-28
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 2 Region: 301-419
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-18
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 3 Region: 702-772,833-867
Classification Level Classification E-value
Superfamily Second domain of FERM 1.14e-16
Family Second domain of FERM 0.0085
Further Details:      
 
Domain Number 4 Region: 238-293
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000944
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Domain Number 5 Region: 85-123
Classification Level Classification E-value
Superfamily PH domain-like 0.00000301
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023791
Domain Number - Region: 612-696
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000108
Family Ras-binding domain, RBD 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023791   Gene: ENSGACG00000018008   Transcript: ENSGACT00000023838
Sequence length 975
Comment pep:known_by_projection group:BROADS1:groupIII:16791897:16798505:-1 gene:ENSGACG00000018008 transcript:ENSGACT00000023838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYDQDDYDEGAIVSSACRAFSNPRSDQWSPDYRGSVGTYSSGAYRFSSEGASPRFEDSED
DFDRFDTDDELSYRRDSVYSCVTLPYFHSFLFIKAGGLINTWKRRWCVLKDETFLWFRAK
QEALKQGWLHKKGGGSSTLSRRNWKRRWFVLRQSKLTYFENDGEEKMKGVLDMHDAKEII
DNTGKENGINIVMPERTYQLIAESAEDASQWFSVLSQVHGSTEQEIREMHHEQANPQNAV
GTLDVGMIDSVCAADNPERPNSFVMITANRVLHCNADTPEEMHHWITLLQRSKGDTRVDG
QEFIIRGWLHKEMRNSSKAALKLKKRWFLLTHNSLDYYKSSERGSLKLGALVLNSLCSVA
PPDERVFKDTGYWSVIVYGRKHSYRLCCKLLNEATRWATSIQNVIDTKAPVDTPTQQLVR
DIKENCLNSEVVEQIYKRNPILRHSHHPLHSPLLPLPYGDIHLSTLRNSSSTTLQEEGLK
VFSSLQHLEGVADPVPVIQGILQTGQELKPLRDELYCQLIKQTVRPPQPGSPGNLCSWKI
LVCMSCTFLPSRSILRYLKFHLKRTRELLPGTEMDRYAAFALDSLKKTRARENVPSQEEI
RSIVSRQDMSTTVHCHGGGSCKITIDSHTTAGEVVEKLIRGLAMEDSRNMFALFEHNATT
EKAIESRSVVADVLAKFEKLSASPDERNTGWKFYFKLYCFLDTENVPKDSVEFAFMFEQA
HEAVIGGQYPGPEETLQFLAALRLQYLQGDHGSPAGVPDMSLVFPMARLRARVQNSAKTF
APGSGSGAERPGASERKRSSFLEGTLRRSFRSGSLSRQKLEEENSLEAWMREEAAAVKTS
LTDKWRKLQGMNQEQAMVKYMSVVKEWQGYGSTLFNVESRDGAFPLELWLGVSREAISVY
KRGEAWPLEVFPYEQILSFGAPLANTYKIAVEGRELVFETQMVMDIAKLMKAYISMIVKK
RYSNCHSVSSHGSQC
Download sequence
Identical sequences G3Q1P3
69293.ENSGACP00000023791 ENSGACP00000023791 ENSGACP00000023791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]