SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023889 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023889
Domain Number 1 Region: 45-479
Classification Level Classification E-value
Superfamily Ras GEF 4.05e-111
Family Ras GEF 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023889   Gene: ENSGACG00000018083   Transcript: ENSGACT00000023936
Sequence length 486
Comment pep:known_by_projection group:BROADS1:groupIV:11350445:11365338:1 gene:ENSGACG00000018083 transcript:ENSGACT00000023936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTVCSGTMFTSSSGFSPHLACAEPGEEEAPQEGPGPGACLADGPPITSASLDTLIHNL
VPTADYYPEKAYVFTFLLSARLFIPPPELLARVCELCIKQQQLDQSPLDTAKVRKFGPKI
LQLLTEWTETFPSDFRDEKMVGHLKDIVHRIAPCDEAYWKTLNQVLQKLSQRLALMSQGE
ESILKVSLNASSISDKLVAFKTKPPHIQKDMLSICNDPYTLAQQLTHVEQEHLSHIGPEE
FVQAFVQKDPLDGTQPCFGDQKKKTFNLEAYVRWFNRLCYLVATEICMPAKKKQRAQVIE
FFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWGKAKTAKFFILEHQMDPTGNFYN
YRTALRGAAHRSRTANSNRERIVIPFFSLLIKDIYFLNEGCANRLPSGHVNFEKFVELAR
QVREFMTWKKVECPFEEDRAILHYLHTAPIFSEDGLYLASYESESPENQVEKDRWKALRS
NILGKT
Download sequence
Identical sequences G3Q1Z0
ENSGACP00000023889 ENSGACP00000023889 69293.ENSGACP00000023889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]