SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023901 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023901
Domain Number 1 Region: 69-195
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000897
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023901
Domain Number - Region: 333-520
Classification Level Classification E-value
Superfamily ARM repeat 0.0297
Family Armadillo repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023901   Gene: ENSGACG00000018094   Transcript: ENSGACT00000023948
Sequence length 638
Comment pep:known_by_projection group:BROADS1:groupXIV:11204875:11223719:1 gene:ENSGACG00000018094 transcript:ENSGACT00000023948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDVVSSHLDEGRREAITGRTTEVMKQFSDVYEQQYAVALFNSIRFEIEGGGAPQSQLLH
RKDALAGRSIFSGSLFQYLEENRKWRNRFVFVPDSYTISLYESKTAHERGLHPKGTINCA
GYKALNSIEQYMELINTSLPGIKAKAGSTPFIKCASQFPLILWHPYARHHYFCVRTEKEQ
KKWHAVLQDCVRHSNNGLSEDCTIQTPAFTDSVRLHRQAKGHYGTWDMMCGKPPQILANL
VMETLHPELRTIIGPRLKGKLQQRQKHWMLISDGVYRQVLSRTTGHYEALMDACEAQRGP
LDARLRTDMDQIIASKEHVSSKMRALVLPKAEQLLRTNVQPYIPSILEALMEPTSRGFSE
VREVFFRELVEISKNSLNGEGKDILGDHMERLSMLALHPVKMQSCYEKVEQLNLDGLQQR
FDVANPSVFVGRAQILMGEQMDNAVYTFEQLLNQSLETKGEDDVCKTIQRCQDRVLKKYD
YDSSTVRKKFFREALLQIIIPYMLQQLSPSYSPELPRFKEMIFEDFSRFLLVGNLFEEVV
LQCVSKDIMMAVKEAAIQRRHNLYRDSIVLTNSDPNLHLLGESPQVDWAAKFGADEPEGC
VGGGRSEGGGSGSRRRQVVSMIQLDGVPLPFESCLEVP
Download sequence
Identical sequences G3Q202
ENSGACP00000023901 69293.ENSGACP00000023901 ENSGACP00000023901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]