SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023919 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023919
Domain Number 1 Region: 27-158
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.87e-28
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023919   Gene: ENSGACG00000018104   Transcript: ENSGACT00000023966
Sequence length 178
Comment pep:known_by_projection group:BROADS1:groupIX:9995241:10015879:-1 gene:ENSGACG00000018104 transcript:ENSGACT00000023966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASVGPQGGPHPPTVPTTMPDLPDLSHLTEEERKIIMAVMARQKEEEDKEQAMLKTLHQ
QFESYKQEVRRIGADTRRQPTQLKDDAPTCGICRKTKFADGCGHLCSYCQTKFCARCGGR
VSLRSNNEDKVVMWVCNLCRKQQEILTKSGEWFSESGVRPGSLGTSLNNPARGGETQR
Download sequence
Identical sequences G3Q220
ENSGACP00000023919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]