SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023928 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023928
Domain Number 1 Region: 317-444
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-37
Family Phosphotyrosine-binding domain (PTB) 0.0000468
Further Details:      
 
Domain Number 2 Region: 168-293
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-19
Family SH2 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023928   Gene: ENSGACG00000018111   Transcript: ENSGACT00000023975
Sequence length 448
Comment pep:known_by_projection group:BROADS1:groupIX:10043700:10049204:-1 gene:ENSGACG00000018111 transcript:ENSGACT00000023975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNSAVSLLSMSTCSDTSYILGSDIYICNTSSSSLRSNLSLASEDADSQEFINTPTYGSLN
ERSRSTASENRQSPEKPPLYKQGNLQERQGKGAQRCPAPHVGSFSSIPVLLINGEPQQDL
HTHSAGPEVDLMQTALNVSNSKPISPQSESHASKSSISRPGFQGRFNGSQPSMKFVMDTS
KFWFRPHINRAEAEALVKDKEAGAFVVRDSTSHRGSFGLAMKVKQTDTNFTATTYPETGE
SGSDLIRNFLIESSAKGVRIKGSSQEPYFGSLSALVYQHTMCAYALPCKLLIHSRAYTDL
VAAEESTNHKPASEDESKTACNFVYLNAVPTEMLTGPCAVQKAVCSTLEKAPGSFTPIIV
NMKVSLKGVTLTDINRKLFFRRHYPAHLLSYSGEDPDDRRWLKGSSSGARMFGFVAKGVE
VGVENVCHVFAEYDPLQSCNKTIEIIQA
Download sequence
Identical sequences G3Q229
ENSGACP00000023928 69293.ENSGACP00000023928 ENSGACP00000023928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]