SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023958 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023958
Domain Number 1 Region: 1353-1546,1588-1728
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.87e-45
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023958
Domain Number - Region: 989-1023
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00251
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023958   Gene: ENSGACG00000018131   Transcript: ENSGACT00000024005
Sequence length 1738
Comment pep:known_by_projection group:BROADS1:groupIV:11522338:11536820:1 gene:ENSGACG00000018131 transcript:ENSGACT00000024005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMEVSLELIGKRLLLLLDDGRSANGSEPEQAAWTRDWLRGIVRAVSVIGLQVPEVFVEFE
NAPQSCSWVQVFDKGVKAVLVEDSIVWASRSDGSTGTAGAPASSTAWPALVYRSLVDKVG
LGSLVPVEYFGNKNFDFLPDNKTVQRFEVDKDIRHPLLLEQPSLQAAINSWRTDFELQEI
FRKGSYTIQGRRVRVYQPEFEECWASGLVSQHDPISHIMEITIDKVGENQTVDPRVIHVM
LAEEVRLSHRSILGKNGRRRKDSETTKGDSGRRRRTASEGDDDLNLKRFKGAGEAAADGK
NGGDSNKMPAEGTGIWGGDSAERVSSTTKNMDQSNAAPRPPSHVKENGRPLPTQGAADST
TAVSHNPTPPPLKPAPSPFSTTSFPSLGQMPSLVPGAPPPKASKSPQPDREEASQSAYSK
TAALVSPGPVTISWSQDSGPSVALSASVGFSPKVPTWGSQTEGSKTASSFGLPKTVPTAS
VFGDVTSQTNGAPAATTASQDTSRPFGFGFGGAKNETQSQQDQNLFFQCMTQNSGPSPSL
AAGPTQSKDTNYFTAVSESLSKEPPSLFKPATSAEGAGGGSAGGRASSLNIGGPSGAAGT
PLSTSKKSSNNGTSVGGLGLQSGFNTSDSHQNLFLQAPKEPANPFLAYGEKTSHASFAGL
TGAEPQTGGPSSEGKPNLFTMAEPPKGFLASSFPVIPAAASPSSSSSPALTSSQRSQSEG
TAVKEEFEVGESPTSTSGCPMFVSTGPGGVEEAPVSFDQSLSQKFSLEERGQLSKRDSDS
SSNSDLSDLSENEEVPEKGQVPGGPLHPAKDGAMLQKTKIQGAAKSRPRNKPFKVSQSVL
KDQNKVRRLKQSGESFLQDGSCINVAPHLHKCRECRLERYRKYRTTGEDSDDDHDPNVSC
RFFHFRRLAFTRKGILRVEGFLSPQQSDSMAMGLWLPAPAVQEGLDLDTSKYILANVGDQ
FCQLVMSEKEAMMMVEPHQKVAWKRAVRGVREMCDVCETTLFNIHWVCRKCGFGVCLDCY
RLRRNRPREDVDEGPDDEVFSWLKCAKGQPHEPQNLMPTQIIPGTALYNIGDMVHSARGK
WGIKANCPCTSRHTKPLVRPSAPNGISQQSTATSSSGILAGAAPGIGTNPKSEGETSAIK
TESTQIAAPSDSGGGESVCSVSNSASGTSSPCNLTQSSAKESRSPGEGNSSALHWLADLA
TQKAKDDTKESGSFRSMMSRDSRPPFGLDSLSALSKPSASSPKLFNSLLLGSSMAQSKPE
GSSLRDLLNSGPGKLPQGPGESGVPFPSVFTSAGSDKLKSSLPNFLDHIIASVVETKKAE
GRRTGAPEGGELGVLGGRKDGVMGLSVLEPHTSHSWLCDGRLLCLQDPSNSNNWKIFREC
WKQGQPVLVSGIHKRLKSELWRPDAFSREFGDQDVDLVNCRNCAIISDVKVRDFWDGFQV
ISKAERLQDAEGQPMVLKLKDWPPGEDFRDMMPTRFDDLMDNLPLPEYTKRDGRLNLAAR
LPNFFVRPDLGPKMYNAYGLTSSEDRKVGTTNLHLDVSDAVNVMVYVGIPLIEGDPGQGS
PEVMTTIEEGDVDEMTKRRVYEAKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPD
HDPIHDQSWYLDQVLRRRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAED
FVSPEHVRHCFRLTQEFRHLSTTHTNHEDKLQVKNIIYHAVKDAVGTLKAHEPKLARP
Download sequence
Identical sequences G3Q259
ENSGACP00000023958 ENSGACP00000023958 69293.ENSGACP00000023958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]