SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024019 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024019
Domain Number 1 Region: 86-288
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-52
Family DBL homology domain (DH-domain) 0.00000146
Further Details:      
 
Domain Number 2 Region: 275-431
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-34
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 555-656,704-730
Classification Level Classification E-value
Superfamily SH2 domain 1.74e-26
Family SH2 domain 0.00073
Further Details:      
 
Domain Number 4 Region: 470-538
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000144
Family SH3-domain 0.00099
Further Details:      
 
Domain Number 5 Region: 404-462
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000179
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0074
Further Details:      
 
Domain Number 6 Region: 662-718
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000569
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024019   Gene: ENSGACG00000018179   Transcript: ENSGACT00000024066
Sequence length 736
Comment pep:known_by_projection group:BROADS1:groupXIV:11850201:11893984:-1 gene:ENSGACG00000018179 transcript:ENSGACT00000024066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPQVISAVSRISHHSIAQIKGISLSPSSHTALNEDDVYRSLEELADEHDLGEDDIYDCVP
CEDDGDDIYEDIIKVEVRQPMKMGMTEDDKRNCCLVEIQETEAKYYKTLEDIEKSYMIPL
KQVMSPQDMEAIFVNLEDVIKVHFALLRAIDLNMVSGGSGLGKIFLDFKERLLIYGQYCS
HMENAQKTLDELIATREDVKIKVEECTMKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLS
HSVDRPERQQLKEALEAMQDLAMYINEVKRDNETLKKISEFQSSIENLQVKLEEYGRPKI
DGELKVSSIVNRTKQDRYIFLFDKVVIVCKRKGYCYELKEIIELQSYKMSDDPMNNRDVK
KWSYGFYLIHLQGKQGFQFFCKTEETKRKWMEQFEMAMSNIKPERATANQHNFQMHTFDK
NTNCRACKMLLSPSRGIFYQGYYCSRCGTGAHKECLEVITICKITSETKHRIVFPGPKMV
AVRNYHGTPAPIGKAALSFQTGEFIELLKGDPDTTWWEGKLIQTQKSGFFPSSCVKPCLD
PKTLSGRQCSRESDYYGYPWFAGNMERQQADNLLKSHSSGTYLIRERTAEAERFAISIKF
NDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQAHSLKESFKLLDTTLRYPYKSRERS
LTRASTRSPVFTPRAVSTAIARYNFAARDMRELSLREGDIVKIYSKIGGDQGWWKGEANG
RIGWFPSTYVDEESVQ
Download sequence
Identical sequences G3Q2C0
ENSGACP00000024019 69293.ENSGACP00000024019 ENSGACP00000024019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]