SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024062 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024062
Domain Number 1 Region: 135-215
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-39
Family variant PHD-like domain 0.0001
Further Details:      
 
Domain Number 2 Region: 207-343
Classification Level Classification E-value
Superfamily EF-hand 0.000000000181
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024062   Gene: ENSGACG00000018201   Transcript: ENSGACT00000024109
Sequence length 411
Comment pep:known_by_projection group:BROADS1:groupXIV:12720507:12743107:-1 gene:ENSGACG00000018201 transcript:ENSGACT00000024109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLMSKKQQVEKVQKCNAVVSAFQAGIKERPAPPKPADEEVEEGDGPAESSATPDQKNA
DEAEEEETDNNADPSTSASARDECKVNQESWSRLRDGKGVEPEDLDKSHQLTPPAFVRPK
READDDQPVEVELLKKEQSPNDEICDVCEVWTADDLYPCRICTRMFHDGCLRELGYLREE
ALQEMKDTAHTVTGWSCYYCDNLNLLLTEEEMYSLMETFKQCKIIPESCLVSDELLQYRH
FASKQQFDKDLTDEQEEEVLGQFSALDPEKKGHIEWSDFLYFESLVVLRKFRSENSMVRL
LTAKERNNARSVFLGLDLDEDGVITRAECRQAQQSWFHKLNKDLQSCNVSISHVGPMCES
SPVSSCSERKSKPLICSSNRPVTWADFLKESAIYLLAARPNSSAMHIRVPL
Download sequence
Identical sequences G3Q2G3
69293.ENSGACP00000024062 ENSGACP00000024062 ENSGACP00000024062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]