SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024067 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024067
Domain Number 1 Region: 484-569
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000746
Family p120GAP domain-like 0.0079
Further Details:      
 
Domain Number 2 Region: 273-347
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000521
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 342-452
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000416
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024067   Gene: ENSGACG00000018205   Transcript: ENSGACT00000024114
Sequence length 569
Comment pep:known_by_projection group:BROADS1:groupIX:10451111:10456499:1 gene:ENSGACG00000018205 transcript:ENSGACT00000024114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGEPPQGQTSETTDPLHTYKWHTGSKGKLNDPKEDKSQKTSTNKWSKMQNWRKALSEDP
GDKHSSGGKGGDGVKPDKGARKNPFRRALSEPPGSTTEPSQRAGGGALLKKYLRTVSQKL
KHHGTLSLLKKNLEEDLPAQLPRLHWAPAQELPLWDISNCILEDGQILISPDEEPMMWTR
NRVSSCLSNLSMQNLIDIDTEKSRSGREGEGIVSVCSYSRRSVNEEGARWKALIKRRLEN
RAKRNSNSQNNPKGLNKGSRHYGSRESVSIPVSALGSLDLSADTSTVIRPVHSSILGEKY
CFEVINSENTHCFGCSSAAERDRWIEDLRRAAQPNKDNIERTENSLNLWVNEAKDLPSKR
SYYCEVHLDGTLFARTSSQAVGKPPDLFWGEFFELDNLPCVSQITLHLFREEDPKKKRHS
RDESSLHPLGSVAIPLAEIQGRTYQEKWYPITPYKASGTVGSKELLGPQASLRIKARFQN
LRVLPMEKYKEFAEYVTVDYVEMSRNLEPLLNVKAKEELAGALVHVLQSIGKAKEFLLDL
GSAEVERLGEKEAMIFRENTLATKAIDEY
Download sequence
Identical sequences G3Q2G8
ENSGACP00000024067 ENSGACP00000024067 69293.ENSGACP00000024067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]