SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024079 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024079
Domain Number 1 Region: 203-528
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.41e-51
Family Diacylglycerol kinase-like 0.011
Further Details:      
 
Domain Number 2 Region: 103-164
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000244
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024079
Domain Number - Region: 42-88
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00349
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024079   Gene: ENSGACG00000018212   Transcript: ENSGACT00000024126
Sequence length 557
Comment pep:known_by_projection group:BROADS1:groupIX:10477593:10481704:-1 gene:ENSGACG00000018212 transcript:ENSGACT00000024126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSREEWTLLLWTTLAVIVPVIVTLWCSAQRSKRKTHMKGFFRKSKHGWHYTDLFHKPTYC
CVCSQHILHGAFCDCCGVCADEQCLRRADRSLTCKEIMAPPCGPSGAMEHRWVRGNVPLA
SYCGSWSRKCLCVPFYAFLMCVWCQTTVHDDCMDGLTADQCELGEFRNLIIPPHYLHRVN
KLRRRTPEEYSQLASSCGSGWTPVLVLANTRSGNNMGEALLGEFRTILNPVQVFDLSELT
PPKALQLCTLLPPGSVQVLVCGGDGTVGWVLDAVDAMKLKGQDQFVPRVTILPLGTGNDL
SNTLGWGAGYAGEIPVEQVLRNILDAEVVKMDRWKVQVASKGLYFRKPKVLSMNNYFSVG
PDALMALNFHTHREKTPSFFSSRIVNKTVYFLYGTKDCLVQECKDLDKRIEPQLELDGES
VALPSLEGIIVCNIGYWGGGCRLWEGMGDEPCAPTRLDDGLLEVVGVFGSFHCAQIQVKL
ANPVRLGQAHTVRLLLKSSKMPMQVDGEPWAQGPCTITITHKTQALMLYHSAEQTDDDED
ESSASEAESPTPHDSPR
Download sequence
Identical sequences G3Q2I0
69293.ENSGACP00000024079 ENSGACP00000024079 ENSGACP00000024079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]