SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024092 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024092
Domain Number 1 Region: 590-731
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-31
Family Synaptotagmin-like (S variant) 0.055
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.12e-26
Family PLC-like (P variant) 0.0000036
Further Details:      
 
Domain Number 3 Region: 1437-1557
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.43e-20
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 4 Region: 455-516
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024092   Gene: ENSGACG00000018217   Transcript: ENSGACT00000024138
Sequence length 1599
Comment pep:known_by_projection group:BROADS1:groupXIV:12795491:12848750:1 gene:ENSGACG00000018217 transcript:ENSGACT00000024138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLFCVTVKKAKLQGPPVSDKYNTYVTLKVQNVKSTTITVRGDQPCWEQDFMFEINRLDL
GLIVEVWNKGLIWDTMVGTAWIPLKGIQQSEEEGLGNWIFLDSEVLMKADEIYGTKNPTP
HRVLLDARFELPFDIPDDEAQYWTGKLERINTMSIHDEYPLQDDVQSRPLPLAASQCCEC
NYFGWAEPLTLDDQDSAVDDRDSDYRSETSLPPRYHTTAQPNSSMHQYPMGPHRLDSCTD
SLHSFDLDYRDQRGPSPVESSRFGSSGNLSQTSSQLSETGQESTGGSEVEESFHAYHSTS
FHPSTNGQPPTNGHSTVGERQKHGLAPEVGRGLLKDPPAERGSSKLLRFNDDGPPLPFSP
SRVRWLKVINKVRVQLREIQDEEPNARQAWLGHSGGSGLYGIDSMPDLRKKKPIPLVSDV
SLVQARKAGIASAMAARSSVKDGELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYC
YECEGLLWGIARQGMRCSECGVKCHEKCQELLNADCLQRAAEKSSKHGAEDRTQNIIMAM
KDRMKIRERNKPEIFELIREVFIVSKATHAQHMKTIKQSVLDGTSKWSAKITITVVCAQG
LQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEEKYHFECHNSSDRIKVRVWDEDD
DIKSRVKQRLKRESDDFLGQSIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLQINVEIK
GEEKVAPYHVQYTCLHENLFHHSTDMLGQGVVKIPEARGDDAWKVYYDDVAQDIVDEFAM
RYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAFYAHTTASTNVSASDRFSASN
FGKERFVKLLDQLHNSLRIDLSTYRNHFPASNKDRLQDLKSTVDLLTSITFFRMKVQELQ
SPPRASQVVKDCVKACLNSTYDYIFNNCHELYSRQYQPIDANKEELPLEEQGPSTKNLDF
WPKLIMLIVSIIEEDRNSYTPVLNQFPQELNVGKVSAEVMWTLFAQDMKYAMEEHEKLRL
CKSTDYMNLHFKVKWLSNEYVKELPNFKGVVPDYPSWFLQFVLQWLEENEDVSMEFMHGA
LERDKKDGFQQTSEHALFSCSVVDIFTQLNQSFEIIKKLECPDPNVMAQYSRRFSKTITK
VLLQYSAILTKSFPTYIDKERIPCVLLNNVQQLRIQLEKMFESMGAKQMDPEASDLLNDL
QVKLNNVLDELSRTFGNSFQNRINDCMRQMASLLYQIKGPLNDNNKNQVDADSDNMLRPL
MDFLDGKLTLFATACEKTVLKRVLKELWRIVMGSLEKTIVLPQGNDTFGAQILSAAKELG
QLSKLKDHMAGEAKSLSPRQCAVMDVALDTIKQYFHAGGNGLKKAFLEKSPELSSLRHAL
SLYTQSTDTLIQTFVTTQHAQVHGGKGMRLTQSEKIQPSKGPAVDKPIGEVSVQIELHTH
PGKGERKVAVKVIGANDLKWQTSGMFRPFVEVTMIGPHLSAKKRKFQTKSKNNTWFPKYN
ESFQFALGNQDGFECYELQVCVKDYCFGRADRVVGVAVVQLRDVAGKGTCACWCPLGQRI
HMDDTGLTAMRILSQRSSDDVAKEFVRLKSETRSAEEGR
Download sequence
Identical sequences G3Q2J3
ENSGACP00000024092 ENSGACP00000024092 69293.ENSGACP00000024092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]