SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024095 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024095
Domain Number 1 Region: 198-339
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-31
Family Synaptotagmin-like (S variant) 0.055
Further Details:      
 
Domain Number 2 Region: 1026-1146
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.67e-21
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 3 Region: 63-124
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000553
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024095   Gene: ENSGACG00000018217   Transcript: ENSGACT00000024142
Sequence length 1188
Comment pep:known_by_projection group:BROADS1:groupXIV:12832381:12848750:1 gene:ENSGACG00000018217 transcript:ENSGACT00000024142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSGLYGIDSMPDLRKKKPIPLVSDVAMSLVQARKAGIASAMAARSSVKDGELKNHVYKK
TLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQELL
NADCLQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFELIREVFIVSKATHAQH
MKTIKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNL
NPVWEEKYHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQSIIEVRTLSGEM
DVWYNLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHVQYTCLHENLFHHSTDMLGQGVV
KIPEARGDDAWKVYYDDVAQDIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMST
LLANINAFYAHTTASTNVSASDRFSASNFGKERFVKLLDQLHNSLRIDLSTYRNHFPASN
KDRLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYDYIFNNCHELY
SRQYQPIDANKEELPLEEQGPSTKNLDFWPKLIMLIVSIIEEDRNSYTPVLNQFPQELNV
GKVSAEVMWTLFAQDMKYAMEEHEKLRLCKSTDYMNLHFKVKWLSNEYVKELPNFKGVVP
DYPSWFLQFVLQWLEENEDVSMEFMHGALERDKKDGFQQTSEHALFSCSVVDIFTQLNQS
FEIIKKLECPDPNVMAQYSRRFSKTITKVLLQYSAILTKSFPTYIDKERIPCVLLNNVQQ
LRIQLEKMFESMGAKQMDPEASDLLNDLQVKLNNVLDELSRTFGNSFQNRINDCMRQMAS
LLYQIKGPLNDNNKNQVDADSDNMLRPLMDFLDGKLTLFATACEKTVLKRVLKELWRIVM
GSLEKTIVLPQGNDTFGAQILSAAKELGQLSKLKDHMAGEAKSLSPRQCAVMDVALDTIK
QYFHAGGNGLKKAFLEKSPELSSLRHALSLYTQSTDTLIQTFVTTQHAQGPAVDKPIGEV
SVQIELHTHPGKGERKVAVKVIGANDLKWQTSGMFRPFVEVTMIGPHLSAKKRKFQTKSK
NNTWFPKYNESFQFALGNQDGFECYELQVCVKDYCFGRADRVVGVAVVQLRDVAGKGTCA
CWCPLGQRIHMDDTGLTAMRILSQRSSDDVAKEFVRLKSETRSAEEGR
Download sequence
Identical sequences G3Q2J6
ENSGACP00000024095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]