SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024100 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024100
Domain Number 1 Region: 388-750
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.19e-127
Family Hect, E3 ligase catalytic domain 0.00000000377
Further Details:      
 
Domain Number 2 Region: 11-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.28e-21
Family PLC-like (P variant) 0.028
Further Details:      
 
Domain Number 3 Region: 294-334
Classification Level Classification E-value
Superfamily WW domain 0.000000000000445
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 153-192
Classification Level Classification E-value
Superfamily WW domain 0.0000000000148
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 248-289
Classification Level Classification E-value
Superfamily WW domain 0.00000000025
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024100   Gene: ENSGACG00000018228   Transcript: ENSGACT00000024147
Sequence length 757
Comment pep:known_by_projection group:BROADS1:groupIX:10649611:10672955:1 gene:ENSGACG00000018228 transcript:ENSGACT00000024147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENREGHKSPGPARFELPVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVRNTLDPK
WNQHYDLYIGKADSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDMNKL
GPNDNDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPSGRPLSCVVDENTPVMTPVNGAEASCPPGEQRIQERRVRSQR
HRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELG
PLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHRVLNHPTQPKDQSGPCVPQPAL
SPAQLPEEAECLTVPKYKRDLVQKLKILRQELSQQQPQAGHCRIEVCREEIFEESYRQVM
KMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINP
DSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHN
SLVWILDNDITGVLDHTFCVEHNAYGEIIQHELKPNGKSVPVSEDTKKEYVRLYVNWRFL
HGIEAQFLALQKGFNEVIPQHLLKSFDEKELELIVCGLGKIDISDWKSNTRLKHCTPDSN
IVKWFWKAVESFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDANANNLP
KAHTCFNRIDIPPYESYDKLYDKLLTAIEETCGFAVE
Download sequence
Identical sequences G3Q2K1
69293.ENSGACP00000024100 ENSGACP00000024100 ENSGACP00000024100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]