SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024109 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024109
Domain Number 1 Region: 193-259
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000207
Family Ras-binding domain, RBD 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024109   Gene: ENSGACG00000018236   Transcript: ENSGACT00000024156
Sequence length 327
Comment pep:known_by_projection group:BROADS1:groupXIV:12999581:13006054:1 gene:ENSGACG00000018236 transcript:ENSGACT00000024156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEFLSLLNTYNCFLKDHTQLHLGYSQGGDGEVVVEGFLNISWGVRRPIRLKIQDDKQMI
PFAPLNSPDPTSPVSPMGDKRGMSRWGECNDLHQVDEMAETPQDTVVTKPLPGPAVYETT
TLRPARQKSHELEAESNLFRCMSDASLVKRRRGTVKSAAQREKERQHRFSINGHFYNYKT
SIFTPSFGTPTKVRITSRMSTNQVIEQLLNKFKIENDPQEFALYCVHQSGEKRKLSERDQ
PLWERILQGPSDDIMKIFLIDMDEEEVSNDVAQYLNLELPILEQVLLQLREEENRVIQRV
VSKYHQQHRLLLHMLTSKMSPHIETSV
Download sequence
Identical sequences G3Q2L0
69293.ENSGACP00000024109 ENSGACP00000024109 ENSGACP00000024109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]