SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024131 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024131
Domain Number 1 Region: 140-267
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-31
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 271-372
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-24
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 3 Region: 51-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000195
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024131   Gene: ENSGACG00000018256   Transcript: ENSGACT00000024179
Sequence length 1554
Comment pep:known_by_projection group:BROADS1:groupIV:12291288:12309422:1 gene:ENSGACG00000018256 transcript:ENSGACT00000024179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYPQSPKSAFISAAKKARLRTNPPKVRFSEQVSISDPDSTMLKDDSLLLIPNVLKVFLEN
GQIKSFTFDSRTTVRDVISSLQDRLSLRYIEHFTLVLEAGGLDQNQRLHLLQDNQPLTHV
VHRTYFQGMKCLFRICFFPKDPADLLRRDPAAFEYLYIQSRNDVIKERFAMDWKSDITLR
LAALHIYITVSSARPNQKISLKHVEKEWGLEPFLPPTLLPTVKEKNVCKSLSQLLKTYQH
PPPSGNKVPPLQGKLQYMRVLNDLPPFGGILFHTVGLDEKQSATTLLVGPRHGISHVIDL
KNNLTTVLAEFSRVVKIQLYRESQGVARVEVTIHEAKPLVLLMEWPEASNFACLISGYYK
LFVDPKRTIYFRTPGQSQLTKAGISSHHAHPRSAATSLPSGGRRGDERESSHRESGSSRA
LVPAESQHLGLCHVHLREQQQFQELQTHGEAELDINENCISHEPPGRPRTKSDPIQQSTE
EIAGVLEIPPVENAGFRIRAQTLCQSQKASQYFCDSCKARHRAEGQSTALNSSGSSGKHC
SSACASRDGGAVDLMALPPPGNEEEDEADGGVEKPPPPPPAAIAAPPPGFRDNSSDEDDP
KRGRKSRTSASLGVASGKLAQTKEAVPVTLIDNVATRTVRDHAQELDDALVSTLQALEAL
AASEDYPHHPQQPTQTAGLIVLAAITPESSLDSGHETNSSELADVSEMVSAMKQNQNQAY
LLAHHINKERILCRRDFPLAIPGCTAKTIGTGAFSVGQIRAGCPTKQVILSKTIPFKVSP
CQDPAVLNVVTEQGGNQETQKEQKAEMKANPESTKANTPDDHSKSPDELKVSSASLTAQV
SKDQKLSSSSGESLRQNLLEGIKGKTTAPLNGDPSSKALPILQPVDRIASAKISPTNMCQ
DAKTASSETMKPSSSTELLSVDGLFCTCPVQQETGPQTKLKDPQVQKIAVYQSSSPTDDE
RLRAKSLQLANSKDNVVRVGADPCLAKPSPQTQMKYSPHLPVKAERKEAAENKTESAPSK
SQPESQKCPIKSLPILDDLTTLSPSVDKVSTLPARDSKMQCSSKSKSQRSAPFLSFKNLL
SATFPARMRRETDERRAQLQKVRQYELEFLEELLKPKSSQGEFLPQGSSPVPSGTPCACQ
LRTSPVLKAPGISREQRRSCDCKRMCRGMRLPDTPVGSTTETQNRGREGPISKTPPAIKT
TRIRSTSLESREPRGEQGSRLPNCTSQSDCTASPQHKKLQRRYSIGELDNSTSMPVYAEV
RPKAKSLEKEMERVRATGLRLPTPVEPVHTQSHQAEGKGKKGVFFIQGEEQMRESKEGTN
SDDKDKCCSFCFCYRKCEAADESSEKEELSYSIPLQVLPGMELDSRTFPVVSKTLQVLDA
EDCSGGEEQEEEEEEEEEEPQTQEIDLRACGTMEGSLARVQALQGKCFCLPDGFLNAQLD
ANELLAILRQCANSPQPEGEARLQPPQIAEYKQELAVRFKEFRASCRRVASVEKSPTRML
AVVTASFQVLCELTQTFIKLVRGVRSETQRLQLLRKVEEVAINYTLLLRAAEES
Download sequence
Identical sequences G3Q2N2
69293.ENSGACP00000024131 ENSGACP00000024131 ENSGACP00000024131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]