SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024190 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024190
Domain Number 1 Region: 34-298
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-72
Family Ras GEF 0.0000479
Further Details:      
 
Domain Number 2 Region: 429-545
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000104
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024190   Gene: ENSGACG00000018302   Transcript: ENSGACT00000024238
Sequence length 554
Comment pep:known_by_projection group:BROADS1:groupXIV:13749154:13782269:1 gene:ENSGACG00000018302 transcript:ENSGACT00000024238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRRNGLSDGTSIHSVTSEASSSSDSLDAPCVDFAKSYDAVVFDVLKVTPEEFASQITLM
DAPVFKAIHPEELASCGWIGKEKHRLSPNVVAFTRRFNQVSFWLVREILTAQTLKIRAEI
LSHFVKIAKKLLELNNLHSLVSVVSALQSAPIFRLSKTWALISRKDKATFEKLNYLTSKE
ENYTRMREYIRSLKMVPRIPYLGIYLLDMIYIDSAYPASDSILETEQRTNQMNNLLRLIS
DLQMSCNYDHLVTLPHVQKYLLSVRYIEELQKFVEDDNFKLSLKIEPGNSSPRIASSKED
LAGLSEVSAPLRYNRRPTCPDASVGVGVPTPPPSHHRKSHSLGNNMMCQYGMSHSRSATF
PTEKARHLLDDSFLESQSPVRTEPHSTSVSNGLSLGSSESSFGEELSPGMESLLLRSSPL
RGCSEASSVTVEGPLRRKTMLKEGRKPKLSSWTRFWIVLSGSTLTFFGAKALRASERKHY
KSSPCKKVCVTGWMVVLPDDPARPNIFHLNDPDKGNVYKFQTGSRFSAIIWHKNLEEACR
SSRPQIPANLMSFE
Download sequence
Identical sequences G3Q2U1
ENSGACP00000024190 ENSGACP00000024190 69293.ENSGACP00000024190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]