SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024268 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024268
Domain Number 1 Region: 59-222
Classification Level Classification E-value
Superfamily RUN domain-like 7.72e-47
Family RUN domain 0.000000254
Further Details:      
 
Domain Number 2 Region: 585-651
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.16e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024268
Domain Number - Region: 254-310
Classification Level Classification E-value
Superfamily Prefoldin 0.00248
Family Prefoldin 0.0083
Further Details:      
 
Domain Number - Region: 425-530
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024268   Gene: ENSGACG00000018354   Transcript: ENSGACT00000024316
Sequence length 655
Comment pep:known_by_projection group:BROADS1:groupIV:13287303:13292669:-1 gene:ENSGACG00000018354 transcript:ENSGACT00000024316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AERPAESGWSAPLRSLARKATETISSGVSYAAAQRSLSTGSAASAPGDFVPPKDPMAIER
SNLLSMMKLSIKVLIQSSMSLGRTLDSEYPPLQQFFIVLEHCLKHGLKAKKSFIGQNKSI
WGPLELVEKLCPESVNIATSARDLPGIKTGLGRGRAWLHLALMQKTVADYMKALLDRKDL
LSEFYDSGALMVEEEGAVMGGLLVGLNVIDANLCIKGEDLDTQVGVIDFSLYLKDPAKSE
TPKDDTKMTAILDQKHYIEELNRHLSGTVTDLQAKMDSIEKTNSKLVEELTAATDRINSL
REEQEQLRKANETILQCTQKKEEAALQDSQVELETYKQTRQGLDEMYNVVWKQYKEEKRI
RQELEHELELQVGLKQEIETAMRLLEKDTHEKQDTLEALRLQLDQVKTLNLQMFHKAQAS
DRVAERKQTEAAQLEGKMDEMERAMMDLEQRLQHSEQQRKHSDQSDEDMREELEGKVEAL
QKQLTDLDTQRLGLETELRTEREHRQSLQKALQQEQDNSTELRTQLQQLQGLQAEVQDLK
HEKRQLQQTCGQQEQALQEMGLHLSQSKLKMEDFKEVNKALKGHAWLKDDEATQCKQCEK
EFSIARRKHHCRNCGDIYCNSCSSNELALPSYPRPVRVCDACHALLLQRSSSTGC
Download sequence
Identical sequences G3Q319
ENSGACP00000024268 ENSGACP00000024268 69293.ENSGACP00000024268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]