SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024275 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024275
Domain Number 1 Region: 105-224
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-26
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily PH domain-like 0.000008
Family Phosphotyrosine-binding domain (PTB) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024275   Gene: ENSGACG00000018358   Transcript: ENSGACT00000024323
Sequence length 635
Comment pep:known_by_projection group:BROADS1:groupIX:11180226:11194329:1 gene:ENSGACG00000018358 transcript:ENSGACT00000024323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTVVAEGQVKLRDGKKWKTRCVVLQKPSPVADCLSLQVYKQKKKGKEKGRGHKERLNV
TLEGICGVEPGPGLDGVSYTLSILCLARTLVLGFNSRDALLAWDARIRYSLGEVHRFRVN
VEPGTKLESGPASLHLCNNLLVLTRGVLPVAIGHWKLSALRRYGAVPNGFVFEGGTRCGI
WAGVFFLSCPEGEQISLLFDCVVRGITSSRPPHGLRPALPDPNADAASTEKRISQAASEL
EKRLSMLSQSSLASSTGDNQSSLSSSSSSHSDASCGSRLSSRGEPLAQPLVSNVTGSSSS
TLKAMTSSDDWLYAAVMGSAGTRPSSAQLHPRGLYDSGWQSSLDSGIGIAAGSQSSSSGS
FSSCTGSLDMAGAGGEGEFTSVHSLPVLSSGPWVSRSCSRASERHSGEYQIPSLLSLQYD
TPRSLLKAMSLGEPSISEAGRYSRSSMSRGDRWDGQGQTLSNMPPGTRAQRLGTTEHSHS
CGSERAPPVESEERATPRPLLVPGGFTYSCEVCYRFYPLLSGPSSFLQSHGSCAGKHLGL
APFFFTPHSELSEYVNLAHTVVGRNRVHFTQVHLAGTGIFTVREQSSIKYSHLDIAAMET
AQRVGAEHVQGREDRRTQLESHGNIKLQNSFHLHE
Download sequence
Identical sequences G3Q326
69293.ENSGACP00000024275 ENSGACP00000024275 ENSGACP00000024275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]