SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024312 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024312
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-26
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 140-241
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-21
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024312   Gene: ENSGACG00000018388   Transcript: ENSGACT00000024361
Sequence length 261
Comment pep:known_by_projection group:BROADS1:groupXIV:14178437:14182861:-1 gene:ENSGACG00000018388 transcript:ENSGACT00000024361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTIGSDIARGPNTPRPACRGYLHKQTHSGLFKGWRRRWFVLTHDCCLFYYRHKRDECKKR
ALFAVKLEGAEVGPDISLGKPFVFKCRPQSSNRVYFLCATSSQERKRWLEAMEKAIHPIT
QNHVWVDVTRHNSNLPPLAVKTPECLGLLHKMDKNKEVWVQHYCVLKDGCLYFYSGIRAT
HAHGGIYLQGYMVREHSYGSKKSTIELRPPTDELNVFHLCAENPHENKRWIIAINASIMR
WQPSRSAFRGFMNRPSEETRM
Download sequence
Identical sequences G3Q362
ENSGACP00000024312 69293.ENSGACP00000024312 ENSGACP00000024312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]