SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024342 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024342
Domain Number 1 Region: 129-275
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.92e-34
Family UAS domain 0.027
Further Details:      
 
Domain Number 2 Region: 348-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.94e-22
Family UBX domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024342
Domain Number - Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.000163
Family TS-N domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024342   Gene: ENSGACG00000018417   Transcript: ENSGACT00000024391
Sequence length 445
Comment pep:known_by_projection group:BROADS1:groupIV:13870547:13875868:-1 gene:ENSGACG00000018417 transcript:ENSGACT00000024391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEEPELSQAQTEKLLQFQDLTGLESMDQCRRTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRVYSYTVSRPQPSGLIGWSYYLIMLPLRYTYSTLLDIFRFAMRF
VRPDPRGRVTDPVGDVVSFIHSFEEKYGQSHPVFYQGTYSQALNDAKRELRFLLVYLHGE
DHQDTDQFCRSTLCTEEVITFLNTQMLFWACSTSKPEGYRVSQALRENTYPFLAMIMLKD
RKMTVVGRLEGLIQPEDFINQLTFIMDANQTHLMSERMEREERSQTQVLRQQQDEAYLAS
LRADQEKDRKKREEEEQLRQEEEKVRQTALAEERRLRTLEEEKERKSECLPPEPPADDPE
SVKIVFKLPNDTRVERRFLFGQSLTVIYDFLFSLKESPEKFQIITNFPRRVLPCLPTEEQ
PNPPTLKEAGLSRSEVLFVQDLTED
Download sequence
Identical sequences G3Q390
ENSGACP00000024342 ENSGACP00000024342 69293.ENSGACP00000024342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]