SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024417 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024417
Domain Number 1 Region: 103-120,179-316
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 390-505
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-16
Family Pleckstrin-homology domain (PH domain) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024417   Gene: ENSGACG00000018467   Transcript: ENSGACT00000024466
Sequence length 765
Comment pep:known_by_projection group:BROADS1:groupIV:14297803:14307421:1 gene:ENSGACG00000018467 transcript:ENSGACT00000024466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERTRAMDVLVSELGVLLKMLDQESLSSSTQEKKASVWNLLQQIQPSGTDYIYMNSAVYR
NGTSFVESLFETFDCELGGLKDITDHLKEDKNTPTGALNQQNCADSPAPPRPEASPPPLP
TTPPPEEYYEEAVPLSPGEMPEYIITRIRPSPPNSMEDGYEDAENNYPSTCINTERKNSY
NDSDALSSSYESYEEDEEERGPGVRLTHQWPSDESSMTPARDCRICAFLLRKKRFGQWAK
QLTVIRENRLQCYKSSKDTSPYVDMLLPQCTVVYAPKDGKRKHHELRFTLPNGDALVLAV
QSQEQARRWLRVVREVSGQSAGPEESASPVIRRKTELDKRLSAERNTSDSDSVGVSTVEN
CKENGETGDGLKYNCKVKRGAFAAGRKITRIISFSKKKPPRCPKSARSVTFPSIFPRRRA
GYVSVLVNQVWRDQWCCVCRGSLHFYNDKGDARTFLPSLPLHGCDVVPGLGPKHPFAFRI
VRHCTEVAALEASSSEELGRWLGVLLAETGSAADPESLHYDYVDVETIANIRDAARHSFL
WATSSSSSSYADSRTYDEVPNEDVQAGENRRQQSGNQVKRRSSFSSSDSDRTKPSVSLKR
TGSSKNQFHMNTKGDFYEPAMLIHVTSLESYLWVCRWKHASLPDICSPLLISAGALHTQT
ANSSIRSPAQILSALDQFTDLEFDLSPESLHFASSLPFAPFLQLSFTVKKKKEKSASRKK
KQNIYSDSLPVNCAAEMRRRPLSVYASASGTVMQKAKEWESKKKT
Download sequence
Identical sequences G3Q3G5
ENSGACP00000024417 69293.ENSGACP00000024417 ENSGACP00000024417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]