SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024442 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024442
Domain Number 1 Region: 350-610
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-69
Family Protein kinases, catalytic subunit 0.0000000404
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-40
Family Pleckstrin-homology domain (PH domain) 0.0000597
Further Details:      
 
Domain Number 3 Region: 231-381
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-31
Family SH2 domain 0.0000194
Further Details:      
 
Domain Number 4 Region: 171-251
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000119
Family SH3-domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024442   Gene: ENSGACG00000018485   Transcript: ENSGACT00000024491
Sequence length 613
Comment pep:known_by_projection group:BROADS1:groupIV:14518669:14524113:1 gene:ENSGACG00000018485 transcript:ENSGACT00000024491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPRVILKGTLIKKSQQKKRTSPCNYKERFFVLDTQDLKYSERRPGRKPMQKGCIELSRI
KCVEIVCSDLPIPCDYKYPFQVFHNNYYLYIFAPDNDCRLRWVRALKEETKSNDLATKYH
PNFWTDGKWRCCQQTGKLATGCHLYDPVGYASKKPLPQLPDKEMELHDTGTVIALQDYTP
PGGADLPLLKDQEYTLVNKGHCDWWAVRDDRGNTGFVPSTYVAEKSGANFQRFQWYNKNI
TRGMAEDLLMKQGKEGAFMVRDSRQAGVYTVSVFTKAPGSNGEKNPRVKHYQIRQTETAE
SKFYLAEKYLFSTIPELIHYHQHNAAGLITRLRHPVSQDGGCCSKDIAGPSTDQWELDPE
ELTFGRELGSGQFGLVLEGRWRDSKVAVKTIREECMSDEDFKEEARIMMRLSHCKLVQLY
AVHTQRSPMCLVFEFMDNGCLSDYLRARKGHFSQDTMLSMCMDVSEGMAYLENCNFIHRD
LAARNCLVSKNNEVKVSDFGMTRFVLDDQYTSSQCSKFPVRWSAPEVIKFSKFSSKSDIW
SFGVFLLPSLCLSLVEYKSKSNVEVVESLSKGLRLLKPRLAPEAIHRLMEWCWKEKPEDR
PSFALLLRELPSL
Download sequence
Identical sequences G3Q3J0
69293.ENSGACP00000024442 ENSGACP00000024442 ENSGACP00000024442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]