SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024454 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024454
Domain Number 1 Region: 269-394
Classification Level Classification E-value
Superfamily Second domain of FERM 6.98e-27
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 397-502
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-23
Family Third domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 31-134
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-19
Family PDZ domain 0.014
Further Details:      
 
Domain Number 4 Region: 179-260
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000248
Family Ras-binding domain, RBD 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024454   Gene: ENSGACG00000018494   Transcript: ENSGACT00000024503
Sequence length 1574
Comment pep:known_by_projection group:BROADS1:groupIX:12502509:12519893:-1 gene:ENSGACG00000018494 transcript:ENSGACT00000024503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQDRSRSPSRRTSRVEQVVGRWLRRSRDLGSRSHSLNRSAECSGFDQRNYPFRFIVQI
QRDPNLNSHGLTLSAQTPILVQEVNPGGPADGRLLPGDQLVKINNIAVDDLTPEQAAEII
RECQDSLTMTVLRTMLGPKSSFITPEKRAKLRSNPVKVHFAEEVEVNGHSQGNSLLFLPN
VLKVYLENGQTKAFKFDPSTTVKDIVMTLKEKLSLSRIEHFSLVLEQRHSISKLLLLHEE
ERIQQVVQKKEAHDFRCLFRVCFMPRTLQTLLQEDPTSFEYLYLQGVNDVLQERFAIEMR
CNSALRLAALHIQERLASCGQSTKTNLKTITKTWGIENFVSSTLLRNMREKDLRKAIGYH
MKKSQSLNDPKQKGLSVDQTRVNYLEELSELKSFGGKSFSATMMLQDRESMVTLLVGARY
GVSQVVNHKLSILSTLTEFSSITRIELLPESDKVSLVKIYLQDIKKPITLLLESTAAKDM
SCLIGGYCRVFVDPNLNVFPWMHNSKKHRVSAEEGYVSRCGSDSDTSSDLDMEALVNLVS
CDERPGHRVRSSSDPEGRKRKDRNRRRNKDGKETGAKPWEDKKQKEEASDSWNNDPRVIA
SPSCDSLDALEEDDLISCSSSSFHSGAPSQIHSHSPVQLHPYSQWHVQPHLLAPPPAHVH
PLVHLKSQERSVDTEASLKEQPTSPSSNIDFVFNFDQSDSRCYYKLCSNITPDSARSLPH
PLNHQQEEHRGEGEEESVKAVDLDPIPILQPPPGFGDSSSDEEFFDAIDRFTSPEDSTSG
ATPRDIRTEMKLDLLSTLSLSDIRVSVTDADKDGKEEEDRKLRKRSRKRRSFVETDYTSR
VSYPELHKNLMEEENDAHALSSDPEPSEQTQNPSPTVSSLTHSEGEPAQLESKPIILGSP
EQTRDPLATSRTRKQEMEMEPDAMEFKSVTDLAKASSPTITVVRCRVDPDGKESADRRES
TEEERKGKEEKKEGLRGNSSNSKRPIIGAERQLEANTPPSCLMDATKKRSNGLLEPHLIA
HEQNLDEEGQTLEGVHEKFNPPSYSPQPPPPSSPLPTMPVLHKSQSDCYLRGEVSGENLG
MKMSSSYPEEIPERHSDKAQLYLDIRASIIEDDANGVASSTRTVGDEVTDSTNSDNVFSD
DDMSNSLISSSSDKKDEWATAGRRSISSATRSDDDSQMEGTASESAESDDSDTTVTGSEV
DGEFFVEINSAKSFQALSEVKELCPPLPVQTDPKPQPQHRHPPLNTGPIKDSPGPITEPP
ATTVNGLQRDPSGLKMDTPGPIKEAPESKMTVTSPVKHRNCTSVLASGCESVVEEVQVPL
EACGCPTVYTNCFGSGDSFDEELTVYEFSCRAQSSAVAQTSSAAVLPLVNSPPLSPLLSP
LSDPSDRLLPQTHKDNIGRLGQQRYPEPPKGFQVLRIDVDQLLSILESGADRSVAGPGCR
HPRDSCPAHFTENKRVLQLEARRLMSGCQKVVGIGQSPEEMLHSLADSFRTLVELAGICL
WFSGCERCDRRNAEAVAGLADVARSFRDFCLAAERASSKRSCQDLSSKLLAKQCTALTAS
VFCLTQLFRTLTAL
Download sequence
Identical sequences G3Q3K2
69293.ENSGACP00000024454 ENSGACP00000024454 ENSGACP00000024454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]