SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024457 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024457
Domain Number 1 Region: 71-207
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-36
Family Regulator of G-protein signaling, RGS 0.0000047
Further Details:      
 
Domain Number 2 Region: 721-801
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.71e-26
Family DIX domain 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024457   Gene: ENSGACG00000018497   Transcript: ENSGACT00000024506
Sequence length 802
Comment pep:known_by_projection group:BROADS1:groupIX:12629170:12642557:1 gene:ENSGACG00000018497 transcript:ENSGACT00000024506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRALTEHISSSFREDAPRPPVPGEEGEASCYNPSRSSKMRAHSKVKESPAPPGCAPRRN
EDGLGEPEGSASPDSPLVRWTKSLHFLLGDQDGAHLFRTFLERENCVDTLDFWFACNGFR
QMDLKDSKTARVAKVIFKRYIENNSIVAKQMKPATKTFIRDSVKKQQIDSAMFDQAQTEI
QSNMEENAYQMFLTSDIYLEYVRAGCENAAYMNHGGLGSLKLMCGYLPPLLEEEEWSCND
LKAKALGSVVGLSAKALRATATIRTAAEVLENSCRSHRRGDPASPYFVNSGYIFAPATSA
NDSEISSDAMTDDSMSMTDSSVDGIPPYKLGTKKQLQREIHRSVKINGQITLPHFPRTHR
LPKEMTPIEPSDFAAQLISRLEKLKREQDTMSSLEERLQQIQEEEEREESVDLAGSTSLH
HPLFPSGSQCEEDPQAILDEHLSRVLKTPGCQSPGVVRHSPRSRSPDRTDAMLSSGRGPF
FGAYPGPTKVLVTGKPSTKHIHHHYIHHHHAGLKTKEQIEAEATQRVQCLCPPGGANYSD
FIPARPVAPWKGLSPPPPLSRCSTLSRRPVKATDEGVSSPRLPFDATDRSQNVWQWILES
ERQGKHKPHSTQGLKKSSPLDSKALPARTPSSWGGGGIGSGAHLRGHHPGHPFIQDPAMP
PLPPPNTAQLEEACRRLEEVSHLTMRPLLFSFFFPPLGERLITLQRCFVTTFNNLTNSRS
KEIMVTYFFCGEEIPYRSMMKTHCLTLGHFKEQLSKKGHYRYYFKKASDEFECGAVFEEV
WEDATVLPMYEGKVLGKVERMD
Download sequence
Identical sequences G3Q3K5
69293.ENSGACP00000024457 ENSGACP00000024457 ENSGACP00000024457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]