SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024469 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024469
Domain Number 1 Region: 2475-2579
Classification Level Classification E-value
Superfamily Bromodomain 9.55e-38
Family Bromodomain 0.0000423
Further Details:      
 
Domain Number 2 Region: 2410-2466
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.02e-16
Family PHD domain 0.0014
Further Details:      
 
Domain Number 3 Region: 249-303
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000332
Family PHD domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024469   Gene: ENSGACG00000018507   Transcript: ENSGACT00000024518
Sequence length 2594
Comment pep:known_by_projection group:BROADS1:groupIX:12738483:12772716:-1 gene:ENSGACG00000018507 transcript:ENSGACT00000024518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDDNSDEEDDNLSYRSDDDELMNDNPSSDLEEEEALGNESDYLEELADDDDASYCTESSF
RSHSTLGSTPGRRKSRALRPQSPIFEAKDIPSMELPKSSEDLQVPTSQLLNVSAVYEVLR
NFGSVLRLSPFRFEDFCAAVASQEQCTLLAETHISLLKAILREEDTSNTTFGPTDVKDVN
STLYFVDGMTWPEVVRAYCESDPEYRHILPLQECEDYPFEPLESKIKVLQFLVDQFLATN
IAREELMSEGVVAYDDHCRVCHRLGDLLCCETCSAVYHLECVKPPLQEVPEDEWQCEVCV
AHKVPGVADCIPEAQRSKPFIRQLPVGFDRHQRKYWFLNRRIVVEEDGEQEDKAIWYYST
KVQLAELIDCLDKEYWEGDLYAALEEIRDEVHAHMDITEDLTNKARGSNKCFLTAANEEI
LDRLRAGKDVTGDGKTQEEATEEKQDGGENPSSDSVAGSGDGTQSLSRPAQSSEENSDGS
AAPRPAPQGPEPPDLADKSSQSSMASLDDTGLGGETCHKKSAATRMVTRLRNPDSKLSQM
KNQQVANKGFKEILVVNAHGDVTRVTTRGKEMIKGTLSQYFKLGQEGKYRVYHNQYSSNT
VALNKHQHREDHDKRRHLSHKFCMTPAGEFKWNGSIYGSKLLTISTLRITIIQLENNVPS
PFMHPNWASHRTNWIKAVQMCSKAREFALALAILECAIKPVAMLPLWKDSLGHTRLNRMT
SMERTMQQATWVKYTFPIKHQVWKQKGEEYRVTGYGGWSWISKTYMQRFVPRLPGNTNAN
YRKELEDPPMTVEESKEEMEEEKKHGVDEKEKSEELSADGSPAEMEVDPTDAPIEEMQSV
FNLIDSDRKGPSLQQEKASVKEEPTESPTRPFNYDVVDVSKGFLTRVAYKKKKSSKLDVL
LERRVKQHIIEERQRQQVPAPKCQIPTPVSSFLNPAASTPVRPRAPLKPETLAQTQLALG
KAVKVEEKSSTQTPSAGKLGGGEVKGESEAELSKTTEETSSPLPPPPPVPDSTHKDSCST
GTQNQTASVPQVLEADLVERTMGPKETDQSKRDCSGQEGVTLPDVHEASEGGIYSSLEQQ
TASVSSNVTTAAHVENTGSEVPDLKSASLRTSCLLNQISSQNTSPSKGIQQNPENVSSLH
PCTEENGTGQQENRETVHGAGPGRPEGNSAPKPVSALPQVNGNDGLASERMLRDSVMSSN
NGVLSPPPLLNSIGKIEERGLLVEDGVQLKPLVNGDLAPLNDYAEAGDKEPSPAAKVESK
TMMSDQDYKPPLKVARLEHNVEAIEANSQSTQHSSAETKPTPVLKIIRMSPSPIPSAEDS
SLSDDFAEENNNTGATEPAKAVITQVTTTTSTTTTTVVCTQMKVAGVPSSASGVVTEPVA
SLTESSAVSTLTTMTKTTVTKVCSPGPDGQSEDGQGEVVAQEEKAALSACVSKSTRDFRG
KTSSVSVTVSLEDSSSTTGRVRLLKFSRTKKTRSDTALPSYRKFVTKSNRKSIFVLPHDD
LKVLARRGGFREVSIFSYNSKPALDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLL
WACLRWDDMAVKPSAAVGTIRTETSDTEITTTEIIKRRDVGFHGIRSEYCIRKIICPLGL
PETPKETHTPQRKGLRSSALRPKKPEPAKQTGPVVIETWVAEEELDLWEIRAFSERVEKE
KAQAAEQAKKRLDQKMGTVTATPTGTPATPIITPKVIVGSLSGHGTPSTKVVLSTKMGTP
VTFQQNKNFQQSFATWVKQGQSTQGVVQQKVLGIIPSSTAGGAQTYTTFQPRTTTLNIRP
NTPGSQQQVLGAGGQIRPGMTVIRTPMQQTGPMGKTILRSPLVVQQGQGGQQVVTQIIRG
QAVSTALSGASPVATVTGQGATNATLSGQAAGQTPPGTPRAQGQGQVKLTLAQLTQLTQA
GVGGTQPALTVMVQGQGQTTGQLQVIPHGVTVIPGPGQQLMQAALPNGQMQRFLFTPLAS
AAAPTSSTGTTLRIFKLGLACYWPSLRYNCGRDLQMMLFPYTPASTVPSSTSTKTPAQPA
QQAAAPVQAGATPLATTSTPSSATPQGQLPPQTQAHMPIQSPTSLQVKTQGGAAQLQLQQ
TPQILGMSGLQQQVQSTSLVCFQVLAQLQAQQGGGSVPQHIKLQLPIQIQQTGTTSAQGG
QIGNVVTIQAASVQEQLQRIQQLREQQQQKKKQAAEAKREQALNAASQSDIIQKHVVMKQ
NAAIEHLKQKKTMTPVEREENQRMIVCNQVMKYILDRIDKDERQATKRKKKEEGMEAKRR
LANASKLSSLLYRHKESLKMEILKKRALLDKELQLEAQEELKKDLLRMRKEKERAQAAAQ
QAAQAAATTAAAHNQQQHTPAHKHGIPPPHHLSPSAASSHKRKREEERETATSAKSKKKK
MISTTNAKESKKEIKLYCVCKTPYDETKFYIGCDRCQNWYHGRCVGILQSEANHIDQYVC
PQCQSTEDAMTVFTPLTDKDYEGLRRILRSLQAHKMAWPFLEPVDTNDAPDYYRVIKEPM
DLSTMEERLQKREYIKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLETFFVQKLKGFK
ASRSHNNKLQSAAS
Download sequence
Identical sequences G3Q3L7
ENSGACP00000024469 ENSGACP00000024469 69293.ENSGACP00000024469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]