SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024481 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024481
Domain Number 1 Region: 322-573
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.65e-81
Family Protein kinases, catalytic subunit 0.0000000887
Further Details:      
 
Domain Number 2 Region: 156-276
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-35
Family Synaptotagmin-like (S variant) 0.00000621
Further Details:      
 
Domain Number 3 Region: 23-85
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 
Domain Number 4 Region: 96-152
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024481   Gene: ENSGACG00000018519   Transcript: ENSGACT00000024530
Sequence length 667
Comment pep:known_by_projection group:BROADS1:groupIX:12793088:12880650:1 gene:ENSGACG00000018519 transcript:ENSGACT00000024530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVNSNDSSTADVANRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHELVTFCCPGADKGPDTDDPRTKHKFKIHTYGSPTFCDHCGSLL
YGLIHQGMKCDSCDMNVHNQCVMNVPSLCGTDYTERRGRLFLKCEVTVDKLLVTVSEGKN
LIPMDPNGLSDPYVKLKLVPDPKNETKQKTKTIRSNLNPKWNETFSFKLKPTDKDRRLSV
EVWDWDRTTRNDFMGALSFGVSELMKAPVCGWYKLLCQEEGEYYNVPISEEDDGNEELRE
KFEKAKLGPGKKGITEADGSQSIQPPFVSLNEVKLSDFSFLAVLGKGSFGKVMLAEMKAT
EELYAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVN
GGDLMYHIQQVGKFKEPQAVFYAAEIAAGLFFLHIKGVIYRDLKLDNVMLDSEGHIKIAD
FGMCKENMAEGVTTRTFCGTPDYIAPEIIAYQPYGLSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTNTIQASGCGLRRADIRDTPLRRIDWER
QNREIQPPFKPKVCGKGAENFDKFFTRTQPQLTPPDELVIANIDQAEFAGFSFINPQFVN
PVLVNSL
Download sequence
Identical sequences G3Q3M9
ENSGACP00000024481 ENSGACP00000024481 69293.ENSGACP00000024481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]