SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024491 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024491
Domain Number 1 Region: 197-334
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-42
Family Third domain of FERM 0.000000338
Further Details:      
 
Domain Number 2 Region: 86-196
Classification Level Classification E-value
Superfamily Second domain of FERM 1.19e-32
Family Second domain of FERM 0.00000266
Further Details:      
 
Domain Number 3 Region: 491-578
Classification Level Classification E-value
Superfamily Moesin tail domain 1.19e-31
Family Moesin tail domain 0.0000218
Further Details:      
 
Domain Number 4 Region: 2-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-23
Family First domain of FERM 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024491   Gene: ENSGACG00000018527   Transcript: ENSGACT00000024540
Sequence length 578
Comment pep:known_by_projection group:BROADS1:groupIV:15199303:15205674:-1 gene:ENSGACG00000018527 transcript:ENSGACT00000024540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QINVRVTTMDAELEFAILPSTTGKQLFDQIVKTIGLRETWFFGLQYQDSKGFSTWLKLNK
RVTAQDVKRDNPLLIKFRAKFYPEDVADELIQEATQRLFFLQVKECILNDDIYCPPETAV
LLASYAVHVKQGDYRKDYHVSGYLAREKLLPQRQVLEQHKLNKNQWEDRIQVWHQEHKGL
LREDAMVEYLKIAQDLEMYGVNYFNIKNKKGSELWLGVDALGLNIYDKKDKMTPKIGFPW
SEIRNISFNDKKFLIKPIDKKAPDFVFYVPRLRINKRILALCMGNHDLYMRRRKPDTIEV
QQMKAQAREEKNKRQIERALLESEKKKRENAEKETEKIARETMELMERLRQIEEQTKRAQ
DELEEQTRRALELEKERTIALEEAERLDKDRRAAVEAKAALLHQSETQIKSQESLATELA
ELTSKISQLEDAKKKKDEEADRWQERATVVEADLERTKEELKTKLMGVHIQDSVHPPMHE
HDETDESSAEASAELTSPDMVRDRSEEERVTEAHKNHRLQKKLKFLSTELAGAVDESKKT
PNDLIHAENVKAGRDKYKTLRQIRRGNTKQRIDEFESM
Download sequence
Identical sequences G3Q3N9
69293.ENSGACP00000024491 ENSGACP00000024491 ENSGACP00000024491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]