SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024499 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024499
Domain Number 1 Region: 39-253
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-58
Family DBL homology domain (DH-domain) 0.0000000041
Further Details:      
 
Domain Number 2 Region: 238-392
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-46
Family Pleckstrin-homology domain (PH domain) 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024499   Gene: ENSGACG00000018533   Transcript: ENSGACT00000024548
Sequence length 459
Comment pep:known_by_projection group:BROADS1:groupIV:15227631:15236724:-1 gene:ENSGACG00000018533 transcript:ENSGACT00000024548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHFLQLWVNQDDVGGEPAEGTSEVQNGHLDPTNDCLCLGSPLQNRDQMRANVINEIMSTE
RHYIKHLKDICEGYLRQCRKRVDMFNDDQLRVIFGNIEDIFRFQMGFVRDLEKQYNTDDP
HLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMRDGRYQHFFEACRLLQQMIDIAI
DGFLLTPVQKICKYPLQLAELLKYTAQEHSDYRYVAAALAVMRNVTQQINERKRRLENID
KIAQWQASVLDWEGDDILDRSSELIYTGELSWIYQPYGRSQQRVFFLFDHQLVLCKKDLI
RRDILYYKGRIDMDRYDVRDAIDGRDDDFNVSVKNAFKLCNKDSEEIHIFLAKKPEEKIR
WLRAFHEERKMVQEDEKIGFEISEYQKRQAAMTVRKVTKQKGVNRCTPPSYPPPQDPLSA
GQYEVTEDMAQGEVFEFSQSKRGQAPFWQNFSRLAPFKK
Download sequence
Identical sequences G3Q3P7
69293.ENSGACP00000024499 ENSGACP00000024499 ENSGACP00000024499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]