SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024509 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024509
Domain Number 1 Region: 534-674
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-35
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.07e-18
Family SAM (sterile alpha motif) domain 0.0023
Further Details:      
 
Domain Number 3 Region: 201-302
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000393
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024509   Gene: ENSGACG00000018542   Transcript: ENSGACT00000024558
Sequence length 1057
Comment pep:known_by_projection group:BROADS1:groupIV:15535758:15580656:-1 gene:ENSGACG00000018542 transcript:ENSGACT00000024558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVMEPISKWTPKQVLDWMKGLDDCLQQYVKSFEREQMGGEQLLHITHQELEELGVTRI
GHQELILEAVDLLCALNYGLETENLRTLSHKLNASAKNLQNFILGRRRGGHYDGRASRRL
PNDFLTSVVDLIGAAKNLLAWLDRSPFASVTEYSLLKNNIVQLCLELTTIVQQDCTVYET
ENKILHVCKTLAGICDHIISLSSDSLVSQSAHLEVVHLTSIMPSEGLGMYIKSTYDGLHV
ITGTTENSPRDQCKKIHAGDKVIQVIHQTVVGWQLKNLVNALREDPCGVILTLKKRPQNT
LSSTPALLRNVRWKPLGLQPVPTSPTSTSPTPVGTLGMSKMDAPSIQDVYILSPVSGLYG
TSSALPREELGLMSCDDISRYSVSSQSGSKGSEAVSYYLDQDSGQYFSLLEGDGPPGPDY
DRGRNTGVRRRDKTPTHGDLRPVSMPPEYNWMAEAKEPSMGKRGSRDSDNSLLRYLSDDK
ILVIEEEPEVPGRESRRDSTRRSRRKSRNPSSPSFPISPSMLSSTLRLDQPPEALPVCTQ
FLKSFHYTSLRTKTKRRSKGSLTSASRRRISCKDLGHGDCEGWLWKKKDAKGYFTQKWRK
YWFILKESCLYWYTNQNDEKAEGFISLPEFRIDRAIECRRKFAFKACHPKIKSFFFATDC
LEEMNRWMNRLGLAAIGYTPDDKVPRHDEDYWSESDQDEVDGSMTLKQEGPSSLCDTYHR
TPSVNSSSPFPEPKHGRHFSSESTHSHSSAEDQRGDGMGMGTGTGSTSTHSSGCRSTHRE
RRSWQDLIETPLTSAGLHFLQTAPGDGDYGGLMGSMVGEMGLYGGLGRQGMSPERRRQAT
LPVRRHHAAERDRERDGPFPLERGPHTHGHSHRRSHKQRSQSLPRNRDPMPGKLLHTPAH
MEERSEDEEAEGQAADILEGEEAEAREPEPLDGLEQLYRALEQANVTALGDPKPCSRQEF
RRCFTQRVRDPLLNDRLHRVRALRSTLKAKESELAVICALLEDPGLCSDTFREWKQWHGE
IYSDICQLNSGTNGQDDLSPLAAPLMTHTHSFIETHV
Download sequence
Identical sequences G3Q3Q7
ENSGACP00000024509 ENSGACP00000024509 69293.ENSGACP00000024509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]