SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024565 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024565
Domain Number 1 Region: 352-615
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-78
Family Protein kinases, catalytic subunit 0.0000000241
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-40
Family Pleckstrin-homology domain (PH domain) 0.0000789
Further Details:      
 
Domain Number 3 Region: 239-384
Classification Level Classification E-value
Superfamily SH2 domain 2.91e-18
Family SH2 domain 0.00013
Further Details:      
 
Domain Number 4 Region: 180-259
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-18
Family SH3-domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024565   Gene: ENSGACG00000018577   Transcript: ENSGACT00000024614
Sequence length 626
Comment pep:known_by_projection group:BROADS1:groupVII:164160:171615:-1 gene:ENSGACG00000018577 transcript:ENSGACT00000024614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGLLLEETLIKRSQQKKRTSPLNYKERLFVLTESQLAYYDGRRERKFQRGSIELRRIR
CAEIVKHGGGIMPCQNKYPFQVVYDNNTLYVFAPNPDSRSLWVQSLKGEIKDNAVVSAKF
HPQFWQEGAWLCCRQAEKLAPGCEEYNLFADIIKVLPPPVSISRKPLPPIPEDERNKKVV
VVALYDFPGTEPHDLSLVKGGEYVILDKCDANWYKARNQQGEDGYIPSNYVTERKSGSLV
QFGWYSKQVNRNKAEELLRKEVSDLVTLLCFFPFTLRHVDETKLMSSGVACIKHYHIKET
LTSPPQFYLAEKHLFSSVPELIEYHKHNAAGLVARLRYPVGKQDKSAPSTAGFSYEKWEI
NPSELTFMKELGSGQFGVVRLGKWRAQHRVAIKAIRAGAMYEEDFIEEAKVMMRLSHPKL
VQLYGVCSQQKPIYIVTEFMEHGCLLNFLRQRRGSFGLGSLLSICLDICEAMEHLEAHRF
IHRDLASRNCLVNDSLVVKVSDFGMTRYVLDDQYTSSSGAKFPVKWSPPEVFNFCKYSSK
SDVWSYGVLMWEVFTEGRMPFEQSQNHEVVTMVTKGQRLHRPKMAPLAIYDIMQLTWQER
PDDRPSFSQLCPMISDALESDTPPPN
Download sequence
Identical sequences G3Q3W1
ENSGACP00000024565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]