SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024582 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024582
Domain Number 1 Region: 496-662
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.15e-71
Family A middle domain of Talin 1 0.000000122
Further Details:      
 
Domain Number 2 Region: 760-896
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.28e-52
Family I/LWEQ domain 0.00000107
Further Details:      
 
Domain Number 3 Region: 2302-2491
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.18e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 667-790
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.23e-51
Family I/LWEQ domain 0.00000244
Further Details:      
 
Domain Number 5 Region: 1852-1980
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-41
Family VBS domain 0.00000368
Further Details:      
 
Domain Number 6 Region: 1231-1368
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-37
Family VBS domain 0.025
Further Details:      
 
Domain Number 7 Region: 202-316
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-33
Family Second domain of FERM 0.000000855
Further Details:      
 
Domain Number 8 Region: 317-407
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 9 Region: 1082-1214
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.19e-22
Family VBS domain 0.04
Further Details:      
 
Domain Number 10 Region: 1474-1561
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000903
Family I/LWEQ domain 0.0077
Further Details:      
 
Domain Number 11 Region: 2015-2139
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000298
Family VBS domain 0.014
Further Details:      
 
Domain Number 12 Region: 1693-1803
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000942
Family alpha-catenin/vinculin 0.059
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024582
Domain Number - Region: 928-990
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000298
Family I/LWEQ domain 0.0055
Further Details:      
 
Domain Number - Region: 1604-1666
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.001
Family alpha-catenin/vinculin 0.082
Further Details:      
 
Domain Number - Region: 91-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00267
Family First domain of FERM 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024582   Gene: ENSGACG00000018584   Transcript: ENSGACT00000024631
Sequence length 2550
Comment pep:known_by_projection group:BROADS1:groupXIV:14744099:14791335:1 gene:ENSGACG00000018584 transcript:ENSGACT00000024631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRRCRAAIMVALSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPNDYGLFLS
DEDPKKGIWLEAGKALDYYMLRNGDTLEYKKKQRSSIRMLDGTVKTVMVDDSKIVSDMLM
TICARIGITNYDEYSLVRDIGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNW
LDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQQARDDILNGSHPLSF
DKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKGEKRIFQAHKNCQNMTEI
EAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWN
LTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLE
GDEESTMLEDSVSPKKSTVLQQQFNRVGKVETGSVALPAIMRSGAGGPESFQMGSMPQAK
QHITSGQMHRGHMPPLTSAQQALTGTINCSMQAVQAAQASLDDFDTLPPLGTDAASQAWR
KNKMDESKHEIHSQVDAITAGTASMVNLTAGNPAETDYTAVGCAVTTISSNLTEMSKGVK
LLAALMEDEGANGQQLLGAAKNLACAVSDMLKTAQPANTEPRQILLQAAGNVGTASGELL
SHIGETDKDPQFQDMLMHLAKAVANAAAALVLKAKNVAQKTEDSAQQNRVIAAATQCALS
TSQLVACTRVVAPTISSPVCQEQLIEASKLVAKSVEGCVEASQGATNDEGLLKQVGVAAT
GVTQALNELLQHIKQYASGGHPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQA
TSDLVNAIKMDAEGESDLENSRKLLSAAKLLADATAKMVEAAKGAAANPDSEEQQQKLRE
AAEGLRMATNAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNRNQAAQQQLV
QSCKVVAEQIPQLVQGVRGSQSQPDSPSAQLALISASQNFLQPGAKMVTASKATVPTISD
QASAMQLGQCAKNLASALAELRATTQKAQEACGPLEIDNALSTVRDLEKHIQEAKASAEE
GKLKPLPGETLEKCSQDLGTSTKAVSSAMAQLLSEVTQGNENYTGMAARDVAQALRSLAS
AARGVAATTGDRPARNAILDCAGDVMDKSGNLIEETKRAVAKPGDAENQQRLAQVAKAVS
QALNRCVNCLPGQRDVDNAIRTVGEASKTLLSDSFPSSGRSFQEVQAHLNEVAAGLNQSA
NEVVQASRGTTQNLASATGKFGQDFNNFLNAGVDMAGTSKSKEDQTQVVSNLKTISMSSS
KLLLAAKALSTDPSSPNLKNQLAAAARAVTDSINQLITMCTRQAPGQKECDNALRELESV
RSMLENPTEAVNELSYFDCIDSVMENSKVLGESMAGISHNAKNSNLPEFGDSVSGGSKAL
CGLTEAAAQAAYLVGVSDPNSSAGQKGLVDPAQFARANQSIQMACQNLVDPACTQSQVLS
AATIVAKHTSALCNACRLASSRTSNPVAKRQFVQSAKEVANTTANLVKSIKALDGAFNQE
NREKCKAATGPLIEAVDNLTAFASNPEFASIPAQISPEGHAAMEPIVAAAKTMLESSTGL
IQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAVEVLNGCIR
EVDQASLAAISQHLTPREDISMENLHQQMAASVNEISNLIDPVAVAARSEASQLGHKVSQ
MASYFEPLIMAAIGTASKIVSSQQQMAVLDQTKTLTESALQMLYTAKEAGGNPKQAAHMQ
EALEESVQMMKEAVDDLGATLAEAASAAGAVGGMVDSINESINKMEDTHSLEPEGTFVDY
QTTMVKTAKAIAVTVQEMVTKSNTNPDDLGGLANQLTNEFGNLANEAKYAAVTAENDEIG
SHIKKQVGELGFSCTGLVTKAGALQCSPNDSFTKKELIEGARKVSEKVSHVLASLQAGNR
GTQACITAASAVSGIIADLDTTIMFATAGTLNRENAETFADHREYILKTAKALVEDTKML
VSGAGASQEKLAQAAQSSVHTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALSN
LISATKAAAGKPHDDPSMLQLKSSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATIEHI
KQELAVFNLSDPPPKTTTPEEFIRTTKGITMATAKAVAAGNSCRQEDIIATANLSRRAIA
DMLHSCKEAAYHPEVSQEVQMRALRFGNECACGYLGLLEHVLVIIQKPSHELKQQLANYS
KRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLRPRTKPK
EADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANAVDDGQWSQGL
ISAARMVAAATNNLCEAANSAVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSQTM
KRLQAAGNAVKRASDNLVKAAQKAAFDAQDDQAVVVKSKMVGGIAQIIAAQEEMLRKERE
LEEARRRLATIRQQQYKFLPSELREDGQEQ
Download sequence
Identical sequences G3Q3X8
ENSGACP00000024582 ENSGACP00000024582 69293.ENSGACP00000024582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]