SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024591 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024591
Domain Number 1 Region: 125-500
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-142
Family Myotubularin-like phosphatases 0.0000000385
Further Details:      
 
Domain Number 2 Region: 8-115
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000111
Family GRAM domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024591   Gene: ENSGACG00000018602   Transcript: ENSGACT00000024640
Sequence length 637
Comment pep:known_by_projection group:BROADS1:groupIV:15857017:15864260:1 gene:ENSGACG00000018602 transcript:ENSGACT00000024640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRLPKVEKVRLLDRVSPRRSRVGTLYLTATHTIFVENEAAVRSETWVLHSLVCSVEK
QAATASGCSLLVRCKNFQVLHFVVPRERECHDVHLSLQRLSQPERCEELYCFSYKPNVDE
EERRREWDFLDLKADYSRMGLPNSLWKLSPVNQHYKVSDTYPADLFVPQSATPPVIVGSS
KFRSRGRFPTLSYYSKENHAAICRSSQPLSGFSARCLEDEQMLEAILRSNPRSDFMYVVD
TRPKLNAIANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSQQKMLEACELRSPSMSDF
LEGLESSGWLKHIKAVLDAAIFIAKVSVLVHCSDGWDRTAQVCSVACVLLDPHYRTLRGF
MVLIEKDWISFGHKFSHRCNHLVGDPKEMSPVIDQFLECAWQIMEQFPCAFEFNARFLIT
IHSHVYSCQYGNFIGNNQRERIALGLRERTHSLWSYLWKNKADYMNPLYRPDHRQTEGLL
RPSTAPYCFKSWRGLYNRFDQGMHPRQSAEDYLSAIQEETQQLEDQLASHQRKIAQLEQE
GGVTWGAVAFDKSPTAWALGSDMELANTPQDYAGGFVTSSPCQHKAPEGSLLLLTHDGNI
SNGSDQESGIADVSCLSPLSEDSARDPDSDEAAYSAA
Download sequence
Identical sequences G3Q3Y7
69293.ENSGACP00000024591 ENSGACP00000024591 ENSGACP00000024591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]