SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024689 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024689
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Sec7 domain 4.97e-49
Family Sec7 domain 0.0000789
Further Details:      
 
Domain Number 2 Region: 177-310
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-26
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024689   Gene: ENSGACG00000018679   Transcript: ENSGACT00000024738
Sequence length 442
Comment pep:known_by_projection group:BROADS1:groupIV:16223245:16230784:1 gene:ENSGACG00000018679 transcript:ENSGACT00000024738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNEFSQLVASEYLSFFNFSGLSLDRALRSFLKAFPLMGETQERERILVHFSRRFCHCNPR
TLNTEDGAHTLTCALMLLNTDLHGHNIGKKMSSQQFISNLDGLNNGKDYPKELLKVLYNS
IKNEKLEWAVEEEELRKSLSELVEEQCEGGSKRVARVTDGSNPFITIPILLNAVTYKHGV
LTRKSHADMDGKRTPRGRRGWKKFYAVLKGMILYLQKDEYKPDADISEVDLKNAVRINHA
LATRATDYSKRANVLKLKTSDWRVFLLHASSEEEMLSWIFRINLVAALFSAPAFPAAIGS
MKKFFRPILPSSSTRLKQEEQLLSHENKLKQMSLELEEHRKSSPSADPKSRESEEYRLKE
HYLTYEKARYETYISLLQAKIRAETDDLEKIEASVMGGLIMEGGLAGRECHIRKTQSSPS
ISQAQGGLNGRAAGCTAPGPRS
Download sequence
Identical sequences G3Q485
ENSGACP00000024689 ENSGACP00000024689 69293.ENSGACP00000024689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]